BLASTX nr result
ID: Mentha26_contig00038428
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00038428 (718 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008992358.1| hypothetical protein Salmi_Mp093 (mitochondr... 65 2e-08 >ref|YP_008992358.1| hypothetical protein Salmi_Mp093 (mitochondrion) [Salvia miltiorrhiza] gi|534292329|gb|AGU16621.1| hypothetical protein Salmi_Mp093 (mitochondrion) [Salvia miltiorrhiza] Length = 281 Score = 65.1 bits (157), Expect = 2e-08 Identities = 37/54 (68%), Positives = 38/54 (70%), Gaps = 3/54 (5%) Frame = +2 Query: 476 ESLTPP---PVAQSVVISQLAQPLLSDEARRTMLYHRYLLLNFGGNDDLRRMIS 628 E LTPP PVA I QL QPLLSDE RR MLY RYL LNFGGND L RM+S Sbjct: 146 EPLTPPEAPPVAPP--IPQLDQPLLSDEDRRAMLYQRYLALNFGGNDSLARMVS 197