BLASTX nr result
ID: Mentha26_contig00038406
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00038406 (320 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36274.1| hypothetical protein MIMGU_mgv1a010929mg [Mimulus... 65 1e-08 >gb|EYU36274.1| hypothetical protein MIMGU_mgv1a010929mg [Mimulus guttatus] Length = 297 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/54 (59%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 166 LIQNPSKRTSKIHSCHLISTAHVT---RRRCDLYDLHKELVPYAEAWAWQKALV 318 L Q PSK H C ST V+ +RRCDLYDLHKELVPY EAW+WQ A+V Sbjct: 16 LTQIPSKSAQISHCCLADSTVPVSPSLKRRCDLYDLHKELVPYTEAWSWQNAIV 69