BLASTX nr result
ID: Mentha26_contig00038383
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00038383 (410 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS61298.1| hypothetical protein M569_13498, partial [Genlise... 55 8e-06 >gb|EPS61298.1| hypothetical protein M569_13498, partial [Genlisea aurea] Length = 329 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/73 (38%), Positives = 45/73 (61%), Gaps = 3/73 (4%) Frame = -2 Query: 343 FKFVMIGSDDEWIGW---LVVKIIVYACLSTLLSLYXXXXXXVFFIYCKASRHELEFEID 173 F+ V+IG +W+G+ L+++ ++ + T+L LY V F++CKASR EL FEI Sbjct: 246 FRRVIIGGGGDWMGFRWVLILETVICTGILTVLILYDVAGTAVLFMHCKASRGELAFEIA 305 Query: 172 SKLGGEYLRLPYD 134 + EY+ LP+D Sbjct: 306 EEFAREYVSLPFD 318