BLASTX nr result
ID: Mentha26_contig00038191
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00038191 (375 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36195.1| hypothetical protein MIMGU_mgv1a012247mg [Mimulus... 64 3e-08 >gb|EYU36195.1| hypothetical protein MIMGU_mgv1a012247mg [Mimulus guttatus] Length = 256 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -1 Query: 375 NALYTFPMNRISRIVKSENLDVRISQEDVFVINKAS 268 NALYTFPMNR+SRI+KSEN DV+ISQE VF+INKAS Sbjct: 179 NALYTFPMNRVSRIIKSENPDVKISQEAVFLINKAS 214