BLASTX nr result
ID: Mentha26_contig00038170
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00038170 (384 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007203562.1| hypothetical protein PRUPE_ppb014730mg, part... 56 6e-06 >ref|XP_007203562.1| hypothetical protein PRUPE_ppb014730mg, partial [Prunus persica] gi|462399093|gb|EMJ04761.1| hypothetical protein PRUPE_ppb014730mg, partial [Prunus persica] Length = 418 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/63 (50%), Positives = 44/63 (69%), Gaps = 4/63 (6%) Frame = -1 Query: 384 VGPENMTQRLLPLIADSDSCWKIFEDALGKE----VTPEMKVLKEKIVEKCEGLPLMAKM 217 VG EN+ RLLPL +D +SCWKIFEDA+ + +++ LK +I +KC GLPL AKM Sbjct: 350 VGEENI-HRLLPL-SDPESCWKIFEDAVENDPILFYPSDLEDLKLEINQKCGGLPLAAKM 407 Query: 216 LGK 208 +G+ Sbjct: 408 MGQ 410