BLASTX nr result
ID: Mentha26_contig00038108
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00038108 (328 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17788.1| hypothetical protein MIMGU_mgv1a001774mg [Mimulus... 59 7e-07 ref|XP_006364384.1| PREDICTED: probable cyclic nucleotide-gated ... 58 2e-06 ref|XP_004235383.1| PREDICTED: probable cyclic nucleotide-gated ... 58 2e-06 ref|XP_002317721.1| cyclic nucleotide-gated ion channel 20 famil... 58 2e-06 ref|XP_006478111.1| PREDICTED: probable cyclic nucleotide-gated ... 55 8e-06 ref|XP_006478110.1| PREDICTED: probable cyclic nucleotide-gated ... 55 8e-06 ref|XP_006478108.1| PREDICTED: probable cyclic nucleotide-gated ... 55 8e-06 ref|XP_006441354.1| hypothetical protein CICLE_v10018948mg [Citr... 55 8e-06 >gb|EYU17788.1| hypothetical protein MIMGU_mgv1a001774mg [Mimulus guttatus] Length = 761 Score = 58.9 bits (141), Expect = 7e-07 Identities = 34/80 (42%), Positives = 43/80 (53%) Frame = -2 Query: 240 MDASEKDEIPMLPAAFLHXXXXXXXXXXXXXXXXXXXSMSIPSNSADSSEYEHNLVGFTG 61 MD SE+DEIPMLP ++ SMSIP NS ++S+YE +LVGFTG Sbjct: 1 MDPSERDEIPMLPTTYVQSDDIVESGNRAFATRTRSASMSIPRNSLETSDYEPSLVGFTG 60 Query: 60 PLRMNRRAPNTQMSGPLYAN 1 PLR + + LYAN Sbjct: 61 PLRAQK------PTASLYAN 74 >ref|XP_006364384.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like isoform X1 [Solanum tuberosum] gi|565397617|ref|XP_006364385.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like isoform X2 [Solanum tuberosum] gi|565397619|ref|XP_006364386.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like isoform X3 [Solanum tuberosum] Length = 771 Score = 57.8 bits (138), Expect = 2e-06 Identities = 32/78 (41%), Positives = 41/78 (52%) Frame = -2 Query: 240 MDASEKDEIPMLPAAFLHXXXXXXXXXXXXXXXXXXXSMSIPSNSADSSEYEHNLVGFTG 61 MD EKDE+PML ++ S+S+P +S DS E + + VG+TG Sbjct: 1 MDTFEKDEMPMLSPSYPQSDGNDAFQNRRSTYRTRSASLSMPMSSMDSFENDSSYVGYTG 60 Query: 60 PLRMNRRAPNTQMSGPLY 7 PLR RR QMSGPLY Sbjct: 61 PLRSERRTSLVQMSGPLY 78 >ref|XP_004235383.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like [Solanum lycopersicum] Length = 771 Score = 57.8 bits (138), Expect = 2e-06 Identities = 32/78 (41%), Positives = 41/78 (52%) Frame = -2 Query: 240 MDASEKDEIPMLPAAFLHXXXXXXXXXXXXXXXXXXXSMSIPSNSADSSEYEHNLVGFTG 61 MD EKDE+PML ++ S+S+P +S DS E + + VG+TG Sbjct: 1 MDTFEKDEMPMLSPSYPQSDGNDAFQNRRSTYRTRSASLSMPMSSIDSFENDSSYVGYTG 60 Query: 60 PLRMNRRAPNTQMSGPLY 7 PLR RR QMSGPLY Sbjct: 61 PLRSERRTSLVQMSGPLY 78 >ref|XP_002317721.1| cyclic nucleotide-gated ion channel 20 family protein [Populus trichocarpa] gi|222858394|gb|EEE95941.1| cyclic nucleotide-gated ion channel 20 family protein [Populus trichocarpa] Length = 769 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = -2 Query: 126 MSIPSNSADSSEYEHNLVGFTGPLRMNRRAPNTQMSGPLYAN 1 +SIP NS +S +E NLVG+TGPLR R+AP QMSGPLY N Sbjct: 40 ISIPVNSMESYGFETNLVGYTGPLRSERKAPLVQMSGPLYIN 81 >ref|XP_006478111.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like isoform X4 [Citrus sinensis] Length = 689 Score = 55.5 bits (132), Expect = 8e-06 Identities = 37/81 (45%), Positives = 40/81 (49%), Gaps = 1/81 (1%) Frame = -2 Query: 240 MDASEKDEIPMLP-AAFLHXXXXXXXXXXXXXXXXXXXSMSIPSNSADSSEYEHNLVGFT 64 M EKDE+PML + SMSI NS DS E E NLVG T Sbjct: 1 MAGDEKDEMPMLSDSQSKSSDRNFDFRLQTFASRTRSASMSITMNSTDSFEPEANLVGLT 60 Query: 63 GPLRMNRRAPNTQMSGPLYAN 1 GPLR RR QMSGPLY+N Sbjct: 61 GPLRNERRTQFLQMSGPLYSN 81 >ref|XP_006478110.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like isoform X3 [Citrus sinensis] Length = 691 Score = 55.5 bits (132), Expect = 8e-06 Identities = 37/81 (45%), Positives = 40/81 (49%), Gaps = 1/81 (1%) Frame = -2 Query: 240 MDASEKDEIPMLP-AAFLHXXXXXXXXXXXXXXXXXXXSMSIPSNSADSSEYEHNLVGFT 64 M EKDE+PML + SMSI NS DS E E NLVG T Sbjct: 1 MAGDEKDEMPMLSDSQSKSSDRNFDFRLQTFASRTRSASMSITMNSTDSFEPEANLVGLT 60 Query: 63 GPLRMNRRAPNTQMSGPLYAN 1 GPLR RR QMSGPLY+N Sbjct: 61 GPLRNERRTQFLQMSGPLYSN 81 >ref|XP_006478108.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like isoform X1 [Citrus sinensis] gi|568848639|ref|XP_006478109.1| PREDICTED: probable cyclic nucleotide-gated ion channel 20, chloroplastic-like isoform X2 [Citrus sinensis] Length = 774 Score = 55.5 bits (132), Expect = 8e-06 Identities = 37/81 (45%), Positives = 40/81 (49%), Gaps = 1/81 (1%) Frame = -2 Query: 240 MDASEKDEIPMLP-AAFLHXXXXXXXXXXXXXXXXXXXSMSIPSNSADSSEYEHNLVGFT 64 M EKDE+PML + SMSI NS DS E E NLVG T Sbjct: 1 MAGDEKDEMPMLSDSQSKSSDRNFDFRLQTFASRTRSASMSITMNSTDSFEPEANLVGLT 60 Query: 63 GPLRMNRRAPNTQMSGPLYAN 1 GPLR RR QMSGPLY+N Sbjct: 61 GPLRNERRTQFLQMSGPLYSN 81 >ref|XP_006441354.1| hypothetical protein CICLE_v10018948mg [Citrus clementina] gi|567897734|ref|XP_006441355.1| hypothetical protein CICLE_v10018948mg [Citrus clementina] gi|557543616|gb|ESR54594.1| hypothetical protein CICLE_v10018948mg [Citrus clementina] gi|557543617|gb|ESR54595.1| hypothetical protein CICLE_v10018948mg [Citrus clementina] Length = 776 Score = 55.5 bits (132), Expect = 8e-06 Identities = 37/81 (45%), Positives = 40/81 (49%), Gaps = 1/81 (1%) Frame = -2 Query: 240 MDASEKDEIPMLP-AAFLHXXXXXXXXXXXXXXXXXXXSMSIPSNSADSSEYEHNLVGFT 64 M EKDE+PML + SMSI NS DS E E NLVG T Sbjct: 1 MAGDEKDEMPMLSDSQSKSSDRNFDFRLQTFASRTRSASMSITMNSTDSFEPEANLVGLT 60 Query: 63 GPLRMNRRAPNTQMSGPLYAN 1 GPLR RR QMSGPLY+N Sbjct: 61 GPLRNERRTQFLQMSGPLYSN 81