BLASTX nr result
ID: Mentha26_contig00038097
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00038097 (400 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45973.1| hypothetical protein MIMGU_mgv1a003210mg [Mimulus... 80 2e-13 emb|CBI16000.3| unnamed protein product [Vitis vinifera] 77 3e-12 ref|XP_002279757.1| PREDICTED: periplasmic beta-glucosidase-like... 77 3e-12 emb|CAN81230.1| hypothetical protein VITISV_033665 [Vitis vinifera] 77 3e-12 ref|XP_004296697.1| PREDICTED: periplasmic beta-glucosidase-like... 76 4e-12 ref|XP_007220051.1| hypothetical protein PRUPE_ppa026252mg [Prun... 74 2e-11 ref|XP_007219979.1| hypothetical protein PRUPE_ppb021184mg [Prun... 74 2e-11 ref|XP_007016181.1| Glycosyl hydrolase family protein [Theobroma... 74 2e-11 ref|XP_007016180.1| Glycosyl hydrolase family protein isoform 6 ... 73 5e-11 ref|XP_007016178.1| Glycosyl hydrolase family protein isoform 4 ... 73 5e-11 ref|XP_007016177.1| Glycosyl hydrolase family protein isoform 3 ... 73 5e-11 ref|XP_007016176.1| Glycosyl hydrolase family protein isoform 2 ... 73 5e-11 ref|XP_007016175.1| Glycosyl hydrolase family protein isoform 1 ... 73 5e-11 ref|XP_002313393.1| glycosyl hydrolase family 3 family protein [... 72 6e-11 ref|XP_002525596.1| hydrolase, hydrolyzing O-glycosyl compounds,... 72 1e-10 ref|XP_007161964.1| hypothetical protein PHAVU_001G112600g [Phas... 71 2e-10 ref|XP_007151483.1| hypothetical protein PHAVU_004G050500g [Phas... 70 2e-10 ref|XP_004240394.1| PREDICTED: lysosomal beta glucosidase-like [... 70 3e-10 ref|XP_004493185.1| PREDICTED: lysosomal beta glucosidase-like i... 70 4e-10 ref|XP_004493184.1| PREDICTED: lysosomal beta glucosidase-like i... 70 4e-10 >gb|EYU45973.1| hypothetical protein MIMGU_mgv1a003210mg [Mimulus guttatus] Length = 600 Score = 80.5 bits (197), Expect = 2e-13 Identities = 31/44 (70%), Positives = 41/44 (93%) Frame = +3 Query: 3 VIYGDYAFEGRLPVTWFKSVDKLPIHAGDNSSEPLFPFGFGLKC 134 VI+GDY F+G+LP+TWF+SVD+LP+H+G+NS +PLFPFGFGL C Sbjct: 557 VIFGDYPFQGKLPMTWFRSVDQLPVHSGENSLDPLFPFGFGLTC 600 >emb|CBI16000.3| unnamed protein product [Vitis vinifera] Length = 586 Score = 76.6 bits (187), Expect = 3e-12 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +3 Query: 3 VIYGDYAFEGRLPVTWFKSVDKLPIHAGDNSSEPLFPFGFGL 128 V++GDY FEGRLPVTWFKSV++LP+H DNS +PLFPFGFGL Sbjct: 536 VVFGDYDFEGRLPVTWFKSVEQLPMHPEDNSYDPLFPFGFGL 577 >ref|XP_002279757.1| PREDICTED: periplasmic beta-glucosidase-like [Vitis vinifera] Length = 720 Score = 76.6 bits (187), Expect = 3e-12 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +3 Query: 3 VIYGDYAFEGRLPVTWFKSVDKLPIHAGDNSSEPLFPFGFGL 128 V++GDY FEGRLPVTWFKSV++LP+H DNS +PLFPFGFGL Sbjct: 670 VVFGDYDFEGRLPVTWFKSVEQLPMHPEDNSYDPLFPFGFGL 711 >emb|CAN81230.1| hypothetical protein VITISV_033665 [Vitis vinifera] Length = 639 Score = 76.6 bits (187), Expect = 3e-12 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +3 Query: 3 VIYGDYAFEGRLPVTWFKSVDKLPIHAGDNSSEPLFPFGFGL 128 V++GDY FEGRLPVTWFKSV++LP+H DNS +PLFPFGFGL Sbjct: 589 VVFGDYDFEGRLPVTWFKSVEQLPMHPEDNSYDPLFPFGFGL 630 >ref|XP_004296697.1| PREDICTED: periplasmic beta-glucosidase-like [Fragaria vesca subsp. vesca] Length = 618 Score = 76.3 bits (186), Expect = 4e-12 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = +3 Query: 3 VIYGDYAFEGRLPVTWFKSVDKLPIHAGDNSSEPLFPFGFGLKC 134 VI+GDY FEG+LPVTWFKSV++LP+ AG NS EPL+P GFGL C Sbjct: 562 VIFGDYNFEGKLPVTWFKSVEQLPLDAGSNSYEPLYPLGFGLTC 605 >ref|XP_007220051.1| hypothetical protein PRUPE_ppa026252mg [Prunus persica] gi|462416513|gb|EMJ21250.1| hypothetical protein PRUPE_ppa026252mg [Prunus persica] Length = 601 Score = 74.3 bits (181), Expect = 2e-11 Identities = 30/44 (68%), Positives = 39/44 (88%) Frame = +3 Query: 3 VIYGDYAFEGRLPVTWFKSVDKLPIHAGDNSSEPLFPFGFGLKC 134 VI+GD+ FEG+LPVTWFK V++LP++AGDNS +PL+P GFGL C Sbjct: 553 VIFGDHDFEGQLPVTWFKRVEQLPVNAGDNSYDPLYPLGFGLAC 596 >ref|XP_007219979.1| hypothetical protein PRUPE_ppb021184mg [Prunus persica] gi|462416441|gb|EMJ21178.1| hypothetical protein PRUPE_ppb021184mg [Prunus persica] Length = 229 Score = 74.3 bits (181), Expect = 2e-11 Identities = 30/44 (68%), Positives = 39/44 (88%) Frame = +3 Query: 3 VIYGDYAFEGRLPVTWFKSVDKLPIHAGDNSSEPLFPFGFGLKC 134 VI+GD+ FEG+LPVTWFK V++LP++AGDNS +PL+P GFGL C Sbjct: 181 VIFGDHDFEGQLPVTWFKRVEQLPVNAGDNSYDPLYPLGFGLAC 224 >ref|XP_007016181.1| Glycosyl hydrolase family protein [Theobroma cacao] gi|508786544|gb|EOY33800.1| Glycosyl hydrolase family protein [Theobroma cacao] Length = 606 Score = 73.9 bits (180), Expect = 2e-11 Identities = 29/44 (65%), Positives = 38/44 (86%) Frame = +3 Query: 3 VIYGDYAFEGRLPVTWFKSVDKLPIHAGDNSSEPLFPFGFGLKC 134 V+YGDY FEGRLP+TWF+++ +LPI++ DNS +PLFP GFGL C Sbjct: 562 VVYGDYEFEGRLPMTWFRAIKQLPINSEDNSCDPLFPLGFGLTC 605 >ref|XP_007016180.1| Glycosyl hydrolase family protein isoform 6 [Theobroma cacao] gi|508786543|gb|EOY33799.1| Glycosyl hydrolase family protein isoform 6 [Theobroma cacao] Length = 472 Score = 72.8 bits (177), Expect = 5e-11 Identities = 28/44 (63%), Positives = 39/44 (88%) Frame = +3 Query: 3 VIYGDYAFEGRLPVTWFKSVDKLPIHAGDNSSEPLFPFGFGLKC 134 V++GD+ FEGRLP+TWF+S+++LP++AG NS +PLFP GFGL C Sbjct: 422 VVFGDFEFEGRLPMTWFRSINQLPMNAGHNSYDPLFPLGFGLTC 465 >ref|XP_007016178.1| Glycosyl hydrolase family protein isoform 4 [Theobroma cacao] gi|590588347|ref|XP_007016179.1| Glycosyl hydrolase family protein isoform 4 [Theobroma cacao] gi|508786541|gb|EOY33797.1| Glycosyl hydrolase family protein isoform 4 [Theobroma cacao] gi|508786542|gb|EOY33798.1| Glycosyl hydrolase family protein isoform 4 [Theobroma cacao] Length = 434 Score = 72.8 bits (177), Expect = 5e-11 Identities = 28/44 (63%), Positives = 39/44 (88%) Frame = +3 Query: 3 VIYGDYAFEGRLPVTWFKSVDKLPIHAGDNSSEPLFPFGFGLKC 134 V++GD+ FEGRLP+TWF+S+++LP++AG NS +PLFP GFGL C Sbjct: 384 VVFGDFEFEGRLPMTWFRSINQLPMNAGHNSYDPLFPLGFGLTC 427 >ref|XP_007016177.1| Glycosyl hydrolase family protein isoform 3 [Theobroma cacao] gi|508786540|gb|EOY33796.1| Glycosyl hydrolase family protein isoform 3 [Theobroma cacao] Length = 607 Score = 72.8 bits (177), Expect = 5e-11 Identities = 28/44 (63%), Positives = 39/44 (88%) Frame = +3 Query: 3 VIYGDYAFEGRLPVTWFKSVDKLPIHAGDNSSEPLFPFGFGLKC 134 V++GD+ FEGRLP+TWF+S+++LP++AG NS +PLFP GFGL C Sbjct: 557 VVFGDFEFEGRLPMTWFRSINQLPMNAGHNSYDPLFPLGFGLTC 600 >ref|XP_007016176.1| Glycosyl hydrolase family protein isoform 2 [Theobroma cacao] gi|508786539|gb|EOY33795.1| Glycosyl hydrolase family protein isoform 2 [Theobroma cacao] Length = 534 Score = 72.8 bits (177), Expect = 5e-11 Identities = 28/44 (63%), Positives = 39/44 (88%) Frame = +3 Query: 3 VIYGDYAFEGRLPVTWFKSVDKLPIHAGDNSSEPLFPFGFGLKC 134 V++GD+ FEGRLP+TWF+S+++LP++AG NS +PLFP GFGL C Sbjct: 484 VVFGDFEFEGRLPMTWFRSINQLPMNAGHNSYDPLFPLGFGLTC 527 >ref|XP_007016175.1| Glycosyl hydrolase family protein isoform 1 [Theobroma cacao] gi|508786538|gb|EOY33794.1| Glycosyl hydrolase family protein isoform 1 [Theobroma cacao] Length = 606 Score = 72.8 bits (177), Expect = 5e-11 Identities = 28/44 (63%), Positives = 39/44 (88%) Frame = +3 Query: 3 VIYGDYAFEGRLPVTWFKSVDKLPIHAGDNSSEPLFPFGFGLKC 134 V++GD+ FEGRLP+TWF+S+++LP++AG NS +PLFP GFGL C Sbjct: 556 VVFGDFEFEGRLPMTWFRSINQLPMNAGHNSYDPLFPLGFGLTC 599 >ref|XP_002313393.1| glycosyl hydrolase family 3 family protein [Populus trichocarpa] gi|222849801|gb|EEE87348.1| glycosyl hydrolase family 3 family protein [Populus trichocarpa] Length = 603 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = +3 Query: 3 VIYGDYAFEGRLPVTWFKSVDKLPIHAGDNSSEPLFPFGFGLKC 134 VI+GDY F GRLPVTWF+ V++LP++ DNS EPLFP GFGL C Sbjct: 553 VIFGDYDFSGRLPVTWFRKVEQLPMNLRDNSEEPLFPLGFGLTC 596 >ref|XP_002525596.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] gi|223535032|gb|EEF36714.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] Length = 603 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = +3 Query: 3 VIYGDYAFEGRLPVTWFKSVDKLPIHAGDNSSEPLFPFGFGL 128 VI+GDY F+G+LPVTWFKSV++LP++ G NS +PLFPFGFGL Sbjct: 557 VIFGDYEFKGKLPVTWFKSVEQLPMNYGANSYDPLFPFGFGL 598 >ref|XP_007161964.1| hypothetical protein PHAVU_001G112600g [Phaseolus vulgaris] gi|593797854|ref|XP_007161965.1| hypothetical protein PHAVU_001G112600g [Phaseolus vulgaris] gi|561035428|gb|ESW33958.1| hypothetical protein PHAVU_001G112600g [Phaseolus vulgaris] gi|561035429|gb|ESW33959.1| hypothetical protein PHAVU_001G112600g [Phaseolus vulgaris] Length = 606 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +3 Query: 3 VIYGDYAFEGRLPVTWFKSVDKLPIHAGDNSSEPLFPFGFGL 128 V+YGDY F GRLP TWFKSVD+LP++ GD +PLFPFGFGL Sbjct: 554 VLYGDYGFTGRLPRTWFKSVDQLPMNVGDPHYDPLFPFGFGL 595 >ref|XP_007151483.1| hypothetical protein PHAVU_004G050500g [Phaseolus vulgaris] gi|561024792|gb|ESW23477.1| hypothetical protein PHAVU_004G050500g [Phaseolus vulgaris] Length = 628 Score = 70.5 bits (171), Expect = 2e-10 Identities = 28/43 (65%), Positives = 37/43 (86%) Frame = +3 Query: 3 VIYGDYAFEGRLPVTWFKSVDKLPIHAGDNSSEPLFPFGFGLK 131 V++GDY F G+LP TWFK+VD+LP++ GD+ +PLFPFGFGLK Sbjct: 579 VLFGDYGFRGKLPRTWFKTVDQLPMNVGDSHYDPLFPFGFGLK 621 >ref|XP_004240394.1| PREDICTED: lysosomal beta glucosidase-like [Solanum lycopersicum] Length = 604 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +3 Query: 3 VIYGDYAFEGRLPVTWFKSVDKLPIHAGDNSSEPLFPFGFGL 128 VI+GD+ F G LP+TWFKSVD+LP+H NS EPLFPFG+GL Sbjct: 556 VIFGDFEFHGTLPMTWFKSVDQLPLHQEQNSYEPLFPFGYGL 597 >ref|XP_004493185.1| PREDICTED: lysosomal beta glucosidase-like isoform X5 [Cicer arietinum] Length = 555 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +3 Query: 3 VIYGDYAFEGRLPVTWFKSVDKLPIHAGDNSSEPLFPFGFGL 128 V+YGDY F G+LP TWFKSVD+LP++ GD +PLFPFGFGL Sbjct: 503 VLYGDYGFTGKLPRTWFKSVDQLPMNVGDPHYDPLFPFGFGL 544 >ref|XP_004493184.1| PREDICTED: lysosomal beta glucosidase-like isoform X4 [Cicer arietinum] Length = 625 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +3 Query: 3 VIYGDYAFEGRLPVTWFKSVDKLPIHAGDNSSEPLFPFGFGL 128 V+YGDY F G+LP TWFKSVD+LP++ GD +PLFPFGFGL Sbjct: 573 VLYGDYGFTGKLPRTWFKSVDQLPMNVGDPHYDPLFPFGFGL 614