BLASTX nr result
ID: Mentha26_contig00038063
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00038063 (515 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39296.1| hypothetical protein MIMGU_mgv1a015360mg [Mimulus... 75 1e-11 >gb|EYU39296.1| hypothetical protein MIMGU_mgv1a015360mg [Mimulus guttatus] Length = 160 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = -3 Query: 129 APEVGFEDLHNADELLHLIEAAAQLGFPRPGSLQPRLRLREPI 1 APEVGFE LH+ADEL HL++A AQLGFPRPGSL+PRLRL EP+ Sbjct: 57 APEVGFEYLHHADELFHLLQAEAQLGFPRPGSLEPRLRLGEPL 99