BLASTX nr result
ID: Mentha26_contig00037968
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00037968 (334 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30618.1| hypothetical protein MIMGU_mgv11b024201mg, partia... 71 2e-10 >gb|EYU30618.1| hypothetical protein MIMGU_mgv11b024201mg, partial [Mimulus guttatus] Length = 231 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/50 (68%), Positives = 44/50 (88%), Gaps = 1/50 (2%) Frame = -3 Query: 332 VRRRKDILSIEGNNA-ANDVQKQKALEKQPVNAGFMLLANEEFEKEKGGY 186 VR+R+++LSI GNNA A++V+K +A EKQPVN G +LLAN+EFEKEKGGY Sbjct: 90 VRKRREVLSITGNNAVADEVEKLRAAEKQPVNNGVLLLANDEFEKEKGGY 139