BLASTX nr result
ID: Mentha26_contig00037892
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00037892 (442 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31230.1| hypothetical protein MIMGU_mgv1a018326mg, partial... 67 2e-09 gb|EPS70900.1| hypothetical protein M569_03859, partial [Genlise... 57 3e-06 >gb|EYU31230.1| hypothetical protein MIMGU_mgv1a018326mg, partial [Mimulus guttatus] Length = 441 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/35 (77%), Positives = 34/35 (97%) Frame = -3 Query: 440 GDDIDYVEPTLLDLHESVKALEISCGFNHTAAIFE 336 GDD+DY+EPTLLD H+SV+AL++SCGFNHTAAIF+ Sbjct: 407 GDDVDYIEPTLLDFHKSVEALQVSCGFNHTAAIFQ 441 >gb|EPS70900.1| hypothetical protein M569_03859, partial [Genlisea aurea] Length = 414 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = -3 Query: 440 GDDIDYVEPTLLDLHESVKALEISCGFNHTAAIFE 336 GDD+DY EP +++H VK L+ISCGFNHTAAIF+ Sbjct: 380 GDDVDYTEPVSVEVHGDVKPLQISCGFNHTAAIFQ 414