BLASTX nr result
ID: Mentha26_contig00037835
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00037835 (310 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007227564.1| hypothetical protein PRUPE_ppa013216mg [Prun... 67 3e-09 ref|XP_007227563.1| hypothetical protein PRUPE_ppa013216mg [Prun... 67 3e-09 ref|XP_002297769.1| hypothetical protein POPTR_0001s06030g [Popu... 67 3e-09 ref|XP_002525451.1| conserved hypothetical protein [Ricinus comm... 65 7e-09 gb|AFW79623.1| hypothetical protein ZEAMMB73_364399 [Zea mays] 65 1e-08 ref|XP_002455409.1| hypothetical protein SORBIDRAFT_03g010300 [S... 65 1e-08 ref|XP_006366090.1| PREDICTED: uncharacterized protein LOC102597... 64 2e-08 ref|XP_004967769.1| PREDICTED: uncharacterized protein LOC101775... 64 2e-08 ref|XP_004245768.1| PREDICTED: uncharacterized protein LOC101256... 64 2e-08 ref|XP_006443375.1| hypothetical protein CICLE_v10022656mg [Citr... 64 2e-08 ref|XP_003566723.1| PREDICTED: uncharacterized protein LOC100829... 64 2e-08 gb|AFK43567.1| unknown [Lotus japonicus] 64 3e-08 ref|XP_006366081.1| PREDICTED: uncharacterized protein LOC102594... 63 4e-08 gb|EMT30453.1| hypothetical protein F775_04261 [Aegilops tauschii] 63 4e-08 ref|XP_004300151.1| PREDICTED: uncharacterized protein LOC101305... 63 4e-08 ref|NP_001042664.1| Os01g0264500 [Oryza sativa Japonica Group] g... 63 4e-08 ref|XP_006644027.1| PREDICTED: uncharacterized protein LOC102701... 62 8e-08 ref|XP_006853979.1| hypothetical protein AMTR_s00036p00223480 [A... 62 8e-08 ref|XP_007132436.1| hypothetical protein PHAVU_011G094200g [Phas... 62 1e-07 ref|XP_004168306.1| PREDICTED: uncharacterized protein LOC101231... 62 1e-07 >ref|XP_007227564.1| hypothetical protein PRUPE_ppa013216mg [Prunus persica] gi|462424500|gb|EMJ28763.1| hypothetical protein PRUPE_ppa013216mg [Prunus persica] Length = 134 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 141 FYGYNRAMPIVRRFIKGPMWLHFFIGAPPVITF 239 FYG+N MP+VRR++KGPMWLHFFIGAPPVI F Sbjct: 52 FYGFNHVMPVVRRWVKGPMWLHFFIGAPPVIVF 84 >ref|XP_007227563.1| hypothetical protein PRUPE_ppa013216mg [Prunus persica] gi|462424499|gb|EMJ28762.1| hypothetical protein PRUPE_ppa013216mg [Prunus persica] Length = 117 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 141 FYGYNRAMPIVRRFIKGPMWLHFFIGAPPVITF 239 FYG+N MP+VRR++KGPMWLHFFIGAPPVI F Sbjct: 52 FYGFNHVMPVVRRWVKGPMWLHFFIGAPPVIVF 84 >ref|XP_002297769.1| hypothetical protein POPTR_0001s06030g [Populus trichocarpa] gi|222845027|gb|EEE82574.1| hypothetical protein POPTR_0001s06030g [Populus trichocarpa] Length = 136 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 141 FYGYNRAMPIVRRFIKGPMWLHFFIGAPPVITF 239 FYG+N MP+VRR++KGPMWLHFFIGAPPVI F Sbjct: 54 FYGFNHVMPVVRRWVKGPMWLHFFIGAPPVIVF 86 >ref|XP_002525451.1| conserved hypothetical protein [Ricinus communis] gi|223535264|gb|EEF36941.1| conserved hypothetical protein [Ricinus communis] Length = 141 Score = 65.5 bits (158), Expect = 7e-09 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +3 Query: 141 FYGYNRAMPIVRRFIKGPMWLHFFIGAPPVITF 239 FYG+N MP+VR+++KGPMWLHFFIGAPPVI F Sbjct: 60 FYGFNHVMPVVRKWVKGPMWLHFFIGAPPVIVF 92 >gb|AFW79623.1| hypothetical protein ZEAMMB73_364399 [Zea mays] Length = 151 Score = 65.1 bits (157), Expect = 1e-08 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 141 FYGYNRAMPIVRRFIKGPMWLHFFIGAPPVITF 239 FYG+N MP+VRR IKGPMW+HFF+GAPPVI F Sbjct: 57 FYGFNHVMPVVRRHIKGPMWMHFFVGAPPVIVF 89 >ref|XP_002455409.1| hypothetical protein SORBIDRAFT_03g010300 [Sorghum bicolor] gi|241927384|gb|EES00529.1| hypothetical protein SORBIDRAFT_03g010300 [Sorghum bicolor] Length = 152 Score = 65.1 bits (157), Expect = 1e-08 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 141 FYGYNRAMPIVRRFIKGPMWLHFFIGAPPVITF 239 FYG+N MP+VRR IKGPMW+HFF+GAPPVI F Sbjct: 57 FYGFNHVMPVVRRHIKGPMWMHFFVGAPPVIVF 89 >ref|XP_006366090.1| PREDICTED: uncharacterized protein LOC102597527 [Solanum tuberosum] Length = 137 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 141 FYGYNRAMPIVRRFIKGPMWLHFFIGAPPVITF 239 FYG+N MPIVRR++KGPMWLHF +GAPPVI F Sbjct: 27 FYGFNHVMPIVRRWVKGPMWLHFLVGAPPVIVF 59 >ref|XP_004967769.1| PREDICTED: uncharacterized protein LOC101775692 [Setaria italica] Length = 155 Score = 64.3 bits (155), Expect = 2e-08 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +3 Query: 141 FYGYNRAMPIVRRFIKGPMWLHFFIGAPPVITF 239 FYG+N MP+VRR+IKGPMW+HF +GAPPVI F Sbjct: 57 FYGFNHTMPVVRRYIKGPMWMHFLVGAPPVIVF 89 >ref|XP_004245768.1| PREDICTED: uncharacterized protein LOC101256111 [Solanum lycopersicum] Length = 150 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 141 FYGYNRAMPIVRRFIKGPMWLHFFIGAPPVITF 239 FYG+N MPIVRR++KGPMWLHF +GAPPVI F Sbjct: 67 FYGFNHVMPIVRRWVKGPMWLHFLVGAPPVIVF 99 >ref|XP_006443375.1| hypothetical protein CICLE_v10022656mg [Citrus clementina] gi|568850792|ref|XP_006479081.1| PREDICTED: uncharacterized protein LOC102612476 [Citrus sinensis] gi|557545637|gb|ESR56615.1| hypothetical protein CICLE_v10022656mg [Citrus clementina] Length = 155 Score = 63.9 bits (154), Expect = 2e-08 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +3 Query: 141 FYGYNRAMPIVRRFIKGPMWLHFFIGAPPVITF 239 FYG+N MP+VRR++KGPMWLHF +GAPPVI F Sbjct: 73 FYGFNHVMPVVRRWVKGPMWLHFLVGAPPVIVF 105 >ref|XP_003566723.1| PREDICTED: uncharacterized protein LOC100829694 [Brachypodium distachyon] Length = 135 Score = 63.9 bits (154), Expect = 2e-08 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 141 FYGYNRAMPIVRRFIKGPMWLHFFIGAPPVITF 239 FY +N AMP+VRR+IKGPMW+HF IGAPPVI F Sbjct: 53 FYAFNHAMPVVRRYIKGPMWIHFLIGAPPVIVF 85 >gb|AFK43567.1| unknown [Lotus japonicus] Length = 133 Score = 63.5 bits (153), Expect = 3e-08 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +3 Query: 141 FYGYNRAMPIVRRFIKGPMWLHFFIGAPPVITF 239 FYG+N MP+VRR++KGPMWLHF IG PPVI F Sbjct: 55 FYGFNHVMPVVRRYVKGPMWLHFLIGTPPVIVF 87 >ref|XP_006366081.1| PREDICTED: uncharacterized protein LOC102594436 isoform X1 [Solanum tuberosum] Length = 145 Score = 63.2 bits (152), Expect = 4e-08 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +3 Query: 141 FYGYNRAMPIVRRFIKGPMWLHFFIGAPPVITF 239 FYG+N MPIVRR +KGPMWLHF +GAPPVI F Sbjct: 68 FYGFNHVMPIVRRCVKGPMWLHFLVGAPPVIVF 100 >gb|EMT30453.1| hypothetical protein F775_04261 [Aegilops tauschii] Length = 478 Score = 63.2 bits (152), Expect = 4e-08 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +3 Query: 141 FYGYNRAMPIVRRFIKGPMWLHFFIGAPPVITF 239 FY +N AMP+VRR+IKGPMW+HF +GAPPV+ F Sbjct: 36 FYAFNHAMPVVRRYIKGPMWMHFLVGAPPVVVF 68 >ref|XP_004300151.1| PREDICTED: uncharacterized protein LOC101305178 [Fragaria vesca subsp. vesca] Length = 135 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +3 Query: 141 FYGYNRAMPIVRRFIKGPMWLHFFIGAPPVITF 239 FYG+N MPIV+R +KGPMWLHFFIGAPPVI F Sbjct: 52 FYGFNYVMPIVQRRVKGPMWLHFFIGAPPVIVF 84 >ref|NP_001042664.1| Os01g0264500 [Oryza sativa Japonica Group] gi|6815055|dbj|BAA90342.1| unknown protein [Oryza sativa Japonica Group] gi|7242916|dbj|BAA92514.1| unknown protein [Oryza sativa Japonica Group] gi|113532195|dbj|BAF04578.1| Os01g0264500 [Oryza sativa Japonica Group] gi|215692929|dbj|BAG88349.1| unnamed protein product [Oryza sativa Japonica Group] gi|218187934|gb|EEC70361.1| hypothetical protein OsI_01289 [Oryza sativa Indica Group] gi|222618156|gb|EEE54288.1| hypothetical protein OsJ_01207 [Oryza sativa Japonica Group] Length = 138 Score = 63.2 bits (152), Expect = 4e-08 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +3 Query: 141 FYGYNRAMPIVRRFIKGPMWLHFFIGAPPVITF 239 FYG+N MP VRR+IKGPMW+HF +GAPPVI F Sbjct: 57 FYGFNHTMPFVRRYIKGPMWMHFLVGAPPVIVF 89 >ref|XP_006644027.1| PREDICTED: uncharacterized protein LOC102701863 [Oryza brachyantha] Length = 139 Score = 62.0 bits (149), Expect = 8e-08 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +3 Query: 141 FYGYNRAMPIVRRFIKGPMWLHFFIGAPPVI 233 FYG+N MP+VRR+IKGPMW+HF +GAPPVI Sbjct: 57 FYGFNHTMPVVRRYIKGPMWIHFLVGAPPVI 87 >ref|XP_006853979.1| hypothetical protein AMTR_s00036p00223480 [Amborella trichopoda] gi|548857647|gb|ERN15446.1| hypothetical protein AMTR_s00036p00223480 [Amborella trichopoda] Length = 212 Score = 62.0 bits (149), Expect = 8e-08 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +3 Query: 141 FYGYNRAMPIVRRFIKGPMWLHFFIGAPPVITF 239 FYG+N AMPIV+++IKGPMW+HF +GAPPVI F Sbjct: 132 FYGFNHAMPIVQKWIKGPMWVHFLVGAPPVILF 164 >ref|XP_007132436.1| hypothetical protein PHAVU_011G094200g [Phaseolus vulgaris] gi|561005436|gb|ESW04430.1| hypothetical protein PHAVU_011G094200g [Phaseolus vulgaris] Length = 134 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +3 Query: 141 FYGYNRAMPIVRRFIKGPMWLHFFIGAPPVITF 239 FYG+N MP+VRR +KGPMWLHF IG PPVI F Sbjct: 56 FYGFNHVMPVVRRSVKGPMWLHFLIGTPPVIVF 88 >ref|XP_004168306.1| PREDICTED: uncharacterized protein LOC101231927 [Cucumis sativus] Length = 121 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +3 Query: 141 FYGYNRAMPIVRRFIKGPMWLHFFIGAPPVITF 239 FYG+N MP+V+R +KGPMWLHF IGAPPVI F Sbjct: 46 FYGFNNVMPVVQRSVKGPMWLHFLIGAPPVIVF 78