BLASTX nr result
ID: Mentha26_contig00037770
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00037770 (315 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006395750.1| hypothetical protein EUTSA_v10004185mg [Eutr... 102 5e-20 ref|XP_002876849.1| hypothetical protein ARALYDRAFT_484201 [Arab... 102 5e-20 ref|XP_004298435.1| PREDICTED: uncharacterized protein LOC101306... 101 1e-19 gb|EYU22427.1| hypothetical protein MIMGU_mgv1a009507mg [Mimulus... 100 3e-19 ref|XP_006292784.1| hypothetical protein CARUB_v10019033mg [Caps... 100 3e-19 ref|XP_007224020.1| hypothetical protein PRUPE_ppa015084mg [Prun... 100 4e-19 ref|NP_178393.2| uncharacterized protein [Arabidopsis thaliana] ... 99 5e-19 gb|AAC32911.1| unknown protein [Arabidopsis thaliana] 99 5e-19 ref|XP_002315801.2| hypothetical protein POPTR_0010s10410g [Popu... 99 6e-19 ref|XP_002449181.1| hypothetical protein SORBIDRAFT_05g006130 [S... 99 8e-19 gb|EEE51805.1| hypothetical protein OsJ_33272 [Oryza sativa Japo... 98 1e-18 gb|EEC67838.1| hypothetical protein OsI_35445 [Oryza sativa Indi... 98 1e-18 ref|NP_001067432.1| Os11g0198100 [Oryza sativa Japonica Group] g... 98 1e-18 gb|ABA91928.2| expressed protein [Oryza sativa Japonica Group] 98 1e-18 ref|XP_004511213.1| PREDICTED: uncharacterized protein LOC101512... 98 1e-18 ref|XP_004511211.1| PREDICTED: uncharacterized protein LOC101512... 98 1e-18 tpg|DAA41921.1| TPA: EMB2756 [Zea mays] 98 1e-18 ref|XP_003628366.1| hypothetical protein MTR_8g055930 [Medicago ... 98 1e-18 ref|XP_002526825.1| conserved hypothetical protein [Ricinus comm... 98 1e-18 gb|EXB43462.1| hypothetical protein L484_006524 [Morus notabilis] 97 2e-18 >ref|XP_006395750.1| hypothetical protein EUTSA_v10004185mg [Eutrema salsugineum] gi|557092389|gb|ESQ33036.1| hypothetical protein EUTSA_v10004185mg [Eutrema salsugineum] Length = 456 Score = 102 bits (254), Expect = 5e-20 Identities = 46/54 (85%), Positives = 52/54 (96%) Frame = -2 Query: 314 FNEVDRFTSRDQLSFAYTYLKLRRLNPDKPLYLHMFKDCERRAITKLFHHRTET 153 FNEVDRFTSRDQLSFAYTYLKL+RLNPD+PL L+MFKDCERRA+TKLFHHR ++ Sbjct: 396 FNEVDRFTSRDQLSFAYTYLKLQRLNPDRPLRLNMFKDCERRALTKLFHHRADS 449 >ref|XP_002876849.1| hypothetical protein ARALYDRAFT_484201 [Arabidopsis lyrata subsp. lyrata] gi|297322687|gb|EFH53108.1| hypothetical protein ARALYDRAFT_484201 [Arabidopsis lyrata subsp. lyrata] Length = 468 Score = 102 bits (254), Expect = 5e-20 Identities = 46/54 (85%), Positives = 52/54 (96%) Frame = -2 Query: 314 FNEVDRFTSRDQLSFAYTYLKLRRLNPDKPLYLHMFKDCERRAITKLFHHRTET 153 FNEVDRFTSRDQLSFAYTYLKL+RLNPD+PL L+MFKDCERRA+TKLFHHR ++ Sbjct: 408 FNEVDRFTSRDQLSFAYTYLKLQRLNPDRPLRLNMFKDCERRALTKLFHHRVDS 461 >ref|XP_004298435.1| PREDICTED: uncharacterized protein LOC101306816 [Fragaria vesca subsp. vesca] Length = 462 Score = 101 bits (251), Expect = 1e-19 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = -2 Query: 314 FNEVDRFTSRDQLSFAYTYLKLRRLNPDKPLYLHMFKDCERRAITKLFHHRTE 156 FNEVDRFTSRDQLSFAYT+LKLRR+NPD+P YL+MFKDCERRA+TKLF HR E Sbjct: 403 FNEVDRFTSRDQLSFAYTFLKLRRMNPDRPFYLNMFKDCERRALTKLFRHRAE 455 >gb|EYU22427.1| hypothetical protein MIMGU_mgv1a009507mg [Mimulus guttatus] Length = 339 Score = 100 bits (248), Expect = 3e-19 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = -2 Query: 314 FNEVDRFTSRDQLSFAYTYLKLRRLNPDKPLYLHMFKDCERRAITKLFHHRTET 153 FNEVDRFTSRDQLSFAYTYLKL+RLNPDK +L+MFKDCERR ITKLF HRT+T Sbjct: 286 FNEVDRFTSRDQLSFAYTYLKLKRLNPDKRFHLNMFKDCERRTITKLFRHRTDT 339 >ref|XP_006292784.1| hypothetical protein CARUB_v10019033mg [Capsella rubella] gi|482561491|gb|EOA25682.1| hypothetical protein CARUB_v10019033mg [Capsella rubella] Length = 460 Score = 100 bits (248), Expect = 3e-19 Identities = 45/54 (83%), Positives = 51/54 (94%) Frame = -2 Query: 314 FNEVDRFTSRDQLSFAYTYLKLRRLNPDKPLYLHMFKDCERRAITKLFHHRTET 153 FNEVDRFTSRDQLSFAYTYLKL+R NPD+PL L+MFKDCERRA+TKLFHHR ++ Sbjct: 400 FNEVDRFTSRDQLSFAYTYLKLQRSNPDRPLRLNMFKDCERRALTKLFHHRVDS 453 >ref|XP_007224020.1| hypothetical protein PRUPE_ppa015084mg [Prunus persica] gi|462420956|gb|EMJ25219.1| hypothetical protein PRUPE_ppa015084mg [Prunus persica] Length = 459 Score = 99.8 bits (247), Expect = 4e-19 Identities = 45/53 (84%), Positives = 48/53 (90%) Frame = -2 Query: 314 FNEVDRFTSRDQLSFAYTYLKLRRLNPDKPLYLHMFKDCERRAITKLFHHRTE 156 FNEVDRFTSRDQLSFAYTYLKLRR+NPD+P YL MFKDCERRA+ KLF HR E Sbjct: 397 FNEVDRFTSRDQLSFAYTYLKLRRMNPDRPFYLSMFKDCERRALVKLFRHREE 449 >ref|NP_178393.2| uncharacterized protein [Arabidopsis thaliana] gi|134031922|gb|ABO45698.1| At2g02910 [Arabidopsis thaliana] gi|330250547|gb|AEC05641.1| uncharacterized protein AT2G02910 [Arabidopsis thaliana] Length = 460 Score = 99.4 bits (246), Expect = 5e-19 Identities = 45/54 (83%), Positives = 51/54 (94%) Frame = -2 Query: 314 FNEVDRFTSRDQLSFAYTYLKLRRLNPDKPLYLHMFKDCERRAITKLFHHRTET 153 FNEVDRFTSRDQLSFAYTYLKL+RLN D+PL L+MFKDCERRA+TKLFHHR ++ Sbjct: 400 FNEVDRFTSRDQLSFAYTYLKLQRLNSDRPLRLNMFKDCERRALTKLFHHRVDS 453 >gb|AAC32911.1| unknown protein [Arabidopsis thaliana] Length = 378 Score = 99.4 bits (246), Expect = 5e-19 Identities = 45/54 (83%), Positives = 51/54 (94%) Frame = -2 Query: 314 FNEVDRFTSRDQLSFAYTYLKLRRLNPDKPLYLHMFKDCERRAITKLFHHRTET 153 FNEVDRFTSRDQLSFAYTYLKL+RLN D+PL L+MFKDCERRA+TKLFHHR ++ Sbjct: 318 FNEVDRFTSRDQLSFAYTYLKLQRLNSDRPLRLNMFKDCERRALTKLFHHRVDS 371 >ref|XP_002315801.2| hypothetical protein POPTR_0010s10410g [Populus trichocarpa] gi|550329510|gb|EEF01972.2| hypothetical protein POPTR_0010s10410g [Populus trichocarpa] Length = 468 Score = 99.0 bits (245), Expect = 6e-19 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = -2 Query: 314 FNEVDRFTSRDQLSFAYTYLKLRRLNPDKPLYLHMFKDCERRAITKLFHHR 162 FNEVDRFTSRDQLSFAYTYLKLRRLNP+KP YL+MFKDCERRA+ KLF HR Sbjct: 409 FNEVDRFTSRDQLSFAYTYLKLRRLNPNKPFYLNMFKDCERRALAKLFRHR 459 >ref|XP_002449181.1| hypothetical protein SORBIDRAFT_05g006130 [Sorghum bicolor] gi|241935024|gb|EES08169.1| hypothetical protein SORBIDRAFT_05g006130 [Sorghum bicolor] Length = 669 Score = 98.6 bits (244), Expect = 8e-19 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = -2 Query: 314 FNEVDRFTSRDQLSFAYTYLKLRRLNPDKPLYLHMFKDCERRAITKLFHHRTE 156 +NEVDRFT RDQLSFAYTYLKLRR+NPDKP L+MFKDCERR+I KLFHHR+E Sbjct: 607 YNEVDRFTPRDQLSFAYTYLKLRRINPDKPFRLNMFKDCERRSIAKLFHHRSE 659 >gb|EEE51805.1| hypothetical protein OsJ_33272 [Oryza sativa Japonica Group] Length = 674 Score = 98.2 bits (243), Expect = 1e-18 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = -2 Query: 314 FNEVDRFTSRDQLSFAYTYLKLRRLNPDKPLYLHMFKDCERRAITKLFHHRTE 156 FNEVDRFT RDQLSFAYTYLKLRR+NP+KP L+MFKDCERR+I KLFHHR+E Sbjct: 612 FNEVDRFTPRDQLSFAYTYLKLRRMNPEKPFRLNMFKDCERRSIAKLFHHRSE 664 >gb|EEC67838.1| hypothetical protein OsI_35445 [Oryza sativa Indica Group] Length = 674 Score = 98.2 bits (243), Expect = 1e-18 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = -2 Query: 314 FNEVDRFTSRDQLSFAYTYLKLRRLNPDKPLYLHMFKDCERRAITKLFHHRTE 156 FNEVDRFT RDQLSFAYTYLKLRR+NP+KP L+MFKDCERR+I KLFHHR+E Sbjct: 612 FNEVDRFTPRDQLSFAYTYLKLRRMNPEKPFRLNMFKDCERRSIAKLFHHRSE 664 >ref|NP_001067432.1| Os11g0198100 [Oryza sativa Japonica Group] gi|113644654|dbj|BAF27795.1| Os11g0198100, partial [Oryza sativa Japonica Group] Length = 247 Score = 98.2 bits (243), Expect = 1e-18 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = -2 Query: 314 FNEVDRFTSRDQLSFAYTYLKLRRLNPDKPLYLHMFKDCERRAITKLFHHRTE 156 FNEVDRFT RDQLSFAYTYLKLRR+NP+KP L+MFKDCERR+I KLFHHR+E Sbjct: 185 FNEVDRFTPRDQLSFAYTYLKLRRMNPEKPFRLNMFKDCERRSIAKLFHHRSE 237 >gb|ABA91928.2| expressed protein [Oryza sativa Japonica Group] Length = 674 Score = 98.2 bits (243), Expect = 1e-18 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = -2 Query: 314 FNEVDRFTSRDQLSFAYTYLKLRRLNPDKPLYLHMFKDCERRAITKLFHHRTE 156 FNEVDRFT RDQLSFAYTYLKLRR+NP+KP L+MFKDCERR+I KLFHHR+E Sbjct: 612 FNEVDRFTPRDQLSFAYTYLKLRRMNPEKPFRLNMFKDCERRSIAKLFHHRSE 664 >ref|XP_004511213.1| PREDICTED: uncharacterized protein LOC101512141 isoform X3 [Cicer arietinum] Length = 398 Score = 97.8 bits (242), Expect = 1e-18 Identities = 44/52 (84%), Positives = 48/52 (92%) Frame = -2 Query: 314 FNEVDRFTSRDQLSFAYTYLKLRRLNPDKPLYLHMFKDCERRAITKLFHHRT 159 FNEVDRFTSRDQLSFAYTYLKLRR+NPD+P L+MFKDCERRA+ KLF HRT Sbjct: 339 FNEVDRFTSRDQLSFAYTYLKLRRMNPDRPFRLYMFKDCERRALVKLFRHRT 390 >ref|XP_004511211.1| PREDICTED: uncharacterized protein LOC101512141 isoform X1 [Cicer arietinum] gi|502158599|ref|XP_004511212.1| PREDICTED: uncharacterized protein LOC101512141 isoform X2 [Cicer arietinum] Length = 478 Score = 97.8 bits (242), Expect = 1e-18 Identities = 44/52 (84%), Positives = 48/52 (92%) Frame = -2 Query: 314 FNEVDRFTSRDQLSFAYTYLKLRRLNPDKPLYLHMFKDCERRAITKLFHHRT 159 FNEVDRFTSRDQLSFAYTYLKLRR+NPD+P L+MFKDCERRA+ KLF HRT Sbjct: 419 FNEVDRFTSRDQLSFAYTYLKLRRMNPDRPFRLYMFKDCERRALVKLFRHRT 470 >tpg|DAA41921.1| TPA: EMB2756 [Zea mays] Length = 667 Score = 97.8 bits (242), Expect = 1e-18 Identities = 44/53 (83%), Positives = 48/53 (90%) Frame = -2 Query: 314 FNEVDRFTSRDQLSFAYTYLKLRRLNPDKPLYLHMFKDCERRAITKLFHHRTE 156 +NEVDRFT RDQLSFAYTYLKLRR NPD+P L+MFKDCERR+I KLFHHRTE Sbjct: 605 YNEVDRFTPRDQLSFAYTYLKLRRTNPDRPFRLNMFKDCERRSIAKLFHHRTE 657 >ref|XP_003628366.1| hypothetical protein MTR_8g055930 [Medicago truncatula] gi|355522388|gb|AET02842.1| hypothetical protein MTR_8g055930 [Medicago truncatula] Length = 469 Score = 97.8 bits (242), Expect = 1e-18 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = -2 Query: 314 FNEVDRFTSRDQLSFAYTYLKLRRLNPDKPLYLHMFKDCERRAITKLFHHR 162 FNEVDRFTSRDQLSFAYTYLKLRR+NPD+PL L+MFKDCERRA+ KLF HR Sbjct: 410 FNEVDRFTSRDQLSFAYTYLKLRRMNPDRPLQLYMFKDCERRALVKLFRHR 460 >ref|XP_002526825.1| conserved hypothetical protein [Ricinus communis] gi|223533829|gb|EEF35560.1| conserved hypothetical protein [Ricinus communis] Length = 722 Score = 97.8 bits (242), Expect = 1e-18 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = -2 Query: 314 FNEVDRFTSRDQLSFAYTYLKLRRLNPDKPLYLHMFKDCERRAITKLFHHRTE 156 FNEV+RFT RDQLSFAYTY KLRR+NPDKP +LHMFKDCERRA+ KLF HR+E Sbjct: 658 FNEVERFTPRDQLSFAYTYQKLRRMNPDKPFHLHMFKDCERRAVAKLFRHRSE 710 >gb|EXB43462.1| hypothetical protein L484_006524 [Morus notabilis] Length = 480 Score = 97.4 bits (241), Expect = 2e-18 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = -2 Query: 314 FNEVDRFTSRDQLSFAYTYLKLRRLNPDKPLYLHMFKDCERRAITKLFHHR 162 FNEVDRFTSRDQLSFAYT+LKL+R+NPDKP YL+MFKDCERRA+ KLF HR Sbjct: 421 FNEVDRFTSRDQLSFAYTFLKLKRMNPDKPFYLNMFKDCERRALAKLFQHR 471