BLASTX nr result
ID: Mentha26_contig00037112
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00037112 (342 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18865.1| hypothetical protein MIMGU_mgv1a025025mg, partial... 72 1e-10 ref|XP_003606459.1| Pentatricopeptide repeat-containing protein ... 60 4e-07 ref|XP_004167072.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 ref|XP_004147297.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 ref|XP_007015464.1| Tetratricopeptide repeat-like superfamily pr... 58 2e-06 ref|XP_007206500.1| hypothetical protein PRUPE_ppa019170mg [Prun... 57 3e-06 ref|XP_006593024.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 ref|XP_004505962.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 >gb|EYU18865.1| hypothetical protein MIMGU_mgv1a025025mg, partial [Mimulus guttatus] Length = 364 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/47 (70%), Positives = 43/47 (91%) Frame = +3 Query: 3 TYRTVLDEMSRQKGSREASRLLEQLQEKKLVDRHTYQKIVYELEDNS 143 TYRTVLDE+SRQKG+ +A R LE++QEKKLVD +TY+K++YELED+S Sbjct: 311 TYRTVLDEISRQKGNEDALRFLEKVQEKKLVDGNTYKKLLYELEDDS 357 >ref|XP_003606459.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355507514|gb|AES88656.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 418 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = +3 Query: 3 TYRTVLDEMSRQKGSREASRLLEQLQEKKLVDRHTYQKIVYELEDN 140 TYRTVLDE+ R+ +EA R L++LQEK LVD HTY+K++Y LED+ Sbjct: 356 TYRTVLDEICRRGRVQEAMRFLQELQEKDLVDGHTYRKLLYVLEDD 401 >ref|XP_004167072.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial-like [Cucumis sativus] Length = 428 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = +3 Query: 3 TYRTVLDEMSRQKGSREASRLLEQLQEKKLVDRHTYQKIVYELEDN 140 TY+TVLDE+ RQ EA+ LL +LQEK LVD HTY+K++Y LED+ Sbjct: 378 TYKTVLDELCRQGKVVEATSLLRELQEKDLVDGHTYRKLLYVLEDD 423 >ref|XP_004147297.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial-like [Cucumis sativus] Length = 428 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = +3 Query: 3 TYRTVLDEMSRQKGSREASRLLEQLQEKKLVDRHTYQKIVYELEDN 140 TY+TVLDE+ RQ EA+ LL +LQEK LVD HTY+K++Y LED+ Sbjct: 378 TYKTVLDELCRQGKVVEATSLLRELQEKDLVDGHTYRKLLYVLEDD 423 >ref|XP_007015464.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] gi|508785827|gb|EOY33083.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] Length = 429 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/46 (54%), Positives = 38/46 (82%) Frame = +3 Query: 3 TYRTVLDEMSRQKGSREASRLLEQLQEKKLVDRHTYQKIVYELEDN 140 TYRT+LDE+ R+ + EA+ LL++LQ+K LVD HTY+K++Y +ED+ Sbjct: 381 TYRTILDEICRRGRAEEATGLLKELQDKDLVDGHTYRKLLYAMEDD 426 >ref|XP_007206500.1| hypothetical protein PRUPE_ppa019170mg [Prunus persica] gi|462402142|gb|EMJ07699.1| hypothetical protein PRUPE_ppa019170mg [Prunus persica] Length = 369 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/46 (58%), Positives = 36/46 (78%) Frame = +3 Query: 3 TYRTVLDEMSRQKGSREASRLLEQLQEKKLVDRHTYQKIVYELEDN 140 TYRTVLDE+ RQ EA RLL++ QEK L++ HTY+K++Y LED+ Sbjct: 313 TYRTVLDEICRQGRVGEAMRLLKEFQEKDLLNGHTYRKLLYVLEDD 358 >ref|XP_006593024.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial-like, partial [Glycine max] Length = 574 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/46 (54%), Positives = 36/46 (78%) Frame = +3 Query: 3 TYRTVLDEMSRQKGSREASRLLEQLQEKKLVDRHTYQKIVYELEDN 140 TY+TVLDE+ R+ +E +R L++LQEK LVD H Y+K++Y LED+ Sbjct: 458 TYKTVLDEICRRGTVQEGTRFLQELQEKDLVDGHAYRKLLYVLEDD 503 >ref|XP_004505962.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial-like [Cicer arietinum] Length = 499 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/46 (56%), Positives = 35/46 (76%) Frame = +3 Query: 3 TYRTVLDEMSRQKGSREASRLLEQLQEKKLVDRHTYQKIVYELEDN 140 TYRTVLDE+ R+ +A L++LQEK LVD HTY+K++Y LED+ Sbjct: 433 TYRTVLDEICRRGRVEDAMSFLQELQEKDLVDGHTYRKLLYVLEDD 478