BLASTX nr result
ID: Mentha26_contig00036985
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00036985 (424 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_006790184.1| hypothetical protein Eab7_0417 [Exiguobacter... 57 2e-06 ref|YP_003596964.1| hypothetical protein BMD_1761 [Bacillus mega... 57 3e-06 >ref|YP_006790184.1| hypothetical protein Eab7_0417 [Exiguobacterium antarcticum B7] gi|504782349|ref|WP_014969451.1| hypothetical protein [Exiguobacterium antarcticum] gi|407060386|gb|AFS69576.1| Hypothetical protein Eab7_0417 [Exiguobacterium antarcticum B7] Length = 314 Score = 57.4 bits (137), Expect = 2e-06 Identities = 32/101 (31%), Positives = 52/101 (51%) Frame = +1 Query: 1 EVIVERRPLSGIADPNARIMEQDEILRVPLHREEVIMEKRVVPTEEVIVRKKEVIDNQVV 180 EV VERRP++ +++++ + VPL E V++ K+ V TEE++V K++V D ++V Sbjct: 204 EVYVERRPVNESETRTEAFVDENDSIHVPLSEERVVVSKQDVVTEEIVVGKRKVQDTEIV 263 Query: 181 GATLRSEYVDTVQTQVSQGASFAGAAHTTGAYGDSRDLNRD 303 T+R E D + G S DL+RD Sbjct: 264 SETVRREEAD-----IDDGTSTTNNLDRDNRLDRDNDLDRD 299 >ref|YP_003596964.1| hypothetical protein BMD_1761 [Bacillus megaterium DSM 319] gi|502847689|ref|WP_013082665.1| hypothetical protein [Bacillus megaterium] gi|294801548|gb|ADF38614.1| conserved hypothetical protein [Bacillus megaterium DSM 319] Length = 298 Score = 56.6 bits (135), Expect = 3e-06 Identities = 32/70 (45%), Positives = 44/70 (62%) Frame = +1 Query: 1 EVIVERRPLSGIADPNARIMEQDEILRVPLHREEVIMEKRVVPTEEVIVRKKEVIDNQVV 180 EV VERRP+S N +I+E +E +R+PL E+V + K V TEEV+V K+ N+ V Sbjct: 214 EVYVERRPVSD-KRANTQIIEDEESVRIPLEEEKVTVSKEPVVTEEVVVGKRRKEKNEKV 272 Query: 181 GATLRSEYVD 210 TLR E V+ Sbjct: 273 SETLRKEEVN 282