BLASTX nr result
ID: Mentha26_contig00036905
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00036905 (340 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS69782.1| hypothetical protein M569_04980, partial [Genlise... 62 1e-07 gb|EYU29889.1| hypothetical protein MIMGU_mgv1a003835mg [Mimulus... 57 3e-06 >gb|EPS69782.1| hypothetical protein M569_04980, partial [Genlisea aurea] Length = 547 Score = 61.6 bits (148), Expect = 1e-07 Identities = 34/73 (46%), Positives = 38/73 (52%), Gaps = 3/73 (4%) Frame = +3 Query: 129 IVFREGLKNWNLKK---ETXXXXXXVSVITTESIXXXXXXXXXXXXXTPWWKDVFKPPER 299 IVF E LK W +KK E V+ ES PWW+DVF PPER Sbjct: 257 IVFSEELKKWRMKKLAGEADSGCPLKKVVAGES--PSPSPPPRENRHPPWWRDVFSPPER 314 Query: 300 GEDYNILQALFSI 338 GEDY +LQALFSI Sbjct: 315 GEDYTVLQALFSI 327 >gb|EYU29889.1| hypothetical protein MIMGU_mgv1a003835mg [Mimulus guttatus] Length = 561 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +3 Query: 264 PWWKDVFKPPERGEDYNILQALFSI 338 PWWKDVF PPERGEDYNILQA+FSI Sbjct: 310 PWWKDVFTPPERGEDYNILQAVFSI 334