BLASTX nr result
ID: Mentha26_contig00036851
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00036851 (367 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19911.1| hypothetical protein MIMGU_mgv1a014115mg [Mimulus... 63 4e-08 >gb|EYU19911.1| hypothetical protein MIMGU_mgv1a014115mg [Mimulus guttatus] Length = 200 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -1 Query: 367 IMEALLHVPGNEDKEKTFRISISDDPPLDCKPCVAARTPQP 245 +MEALLHVP E E+TFRI++SD+PPLDCKPC AA PQP Sbjct: 144 MMEALLHVPTKEKNEQTFRITVSDNPPLDCKPC-AASMPQP 183