BLASTX nr result
ID: Mentha26_contig00036845
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00036845 (432 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45743.1| hypothetical protein MIMGU_mgv11b018472mg [Mimulu... 57 3e-06 >gb|EYU45743.1| hypothetical protein MIMGU_mgv11b018472mg [Mimulus guttatus] Length = 480 Score = 57.0 bits (136), Expect = 3e-06 Identities = 35/100 (35%), Positives = 57/100 (57%), Gaps = 7/100 (7%) Frame = -3 Query: 355 DIPNIQKFSCTGSGLPHLSIKTSSKEWEFNITIACTSFHNTSWFRNLKKTLAKFRQSRIS 176 D PNI F C S +P +S T+S+EW+ +I++ F ++SWF +K+ L +S+IS Sbjct: 283 DAPNIVCFKCNESRVPSISFATTSREWKSDISLTPDEF-SSSWFLKIKELLKSLSRSKIS 341 Query: 175 LSMSVGRGSSEHAV--NIGAV-----PNPLMLENLMIDAP 77 L++ G ++ V NI V NP+++E L +D P Sbjct: 342 LTI----GGFDYIVQENINTVQDNDCDNPVVVECLRLDCP 377