BLASTX nr result
ID: Mentha26_contig00036761
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00036761 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAZ40333.1| hypothetical protein [Raphanus sativus] 76 6e-12 >emb|CAZ40333.1| hypothetical protein [Raphanus sativus] Length = 785 Score = 75.9 bits (185), Expect = 6e-12 Identities = 39/72 (54%), Positives = 49/72 (68%) Frame = -2 Query: 363 KLSSRKIGPLEVLEKINPNAYRLRLPSHMRTSDVFNVKHLLPYQXXXXXXXXXXXSRANR 184 KL S+K+GP+EV+E+INPN YR+RLPSH+RTSDVFN+KHL P++ AN Sbjct: 719 KLKSKKLGPVEVVERINPNVYRVRLPSHLRTSDVFNIKHLSPFKGDNDDPDSW----ANP 774 Query: 183 HSPGENDGDDAA 148 PG G DAA Sbjct: 775 SQPG---GPDAA 783