BLASTX nr result
ID: Mentha26_contig00036680
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00036680 (471 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22373.1| hypothetical protein MIMGU_mgv1a001842mg [Mimulus... 60 4e-07 gb|EYU28858.1| hypothetical protein MIMGU_mgv1a020475mg [Mimulus... 58 2e-06 ref|XP_006484190.1| PREDICTED: pentatricopeptide repeat-containi... 56 4e-06 ref|XP_006348701.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 ref|XP_004239056.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 ref|NP_564247.1| pentatricopeptide repeat-containing protein [Ar... 56 6e-06 gb|AAM61409.1| unknown [Arabidopsis thaliana] 56 6e-06 ref|XP_006303169.1| hypothetical protein CARUB_v10008572mg [Caps... 55 8e-06 >gb|EYU22373.1| hypothetical protein MIMGU_mgv1a001842mg [Mimulus guttatus] Length = 751 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/45 (55%), Positives = 37/45 (82%) Frame = +1 Query: 1 LRKIRRRCAREMDHEADGKVVDLARQLKVIMRSEKRKNILFDIQY 135 L+KIRRRC REMD+++D KV ARQLK+ + +E R+++LF++QY Sbjct: 702 LKKIRRRCVREMDYDSDAKVESFARQLKIRLGTESRRDVLFNLQY 746 >gb|EYU28858.1| hypothetical protein MIMGU_mgv1a020475mg [Mimulus guttatus] Length = 606 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/45 (55%), Positives = 36/45 (80%) Frame = +1 Query: 1 LRKIRRRCAREMDHEADGKVVDLARQLKVIMRSEKRKNILFDIQY 135 L+K+RRRC REMD+E+D KV LARQ K+ M +E R+++LF++ Y Sbjct: 557 LKKVRRRCVREMDYESDEKVESLARQFKIRMGTEVRRDLLFNLHY 601 >ref|XP_006484190.1| PREDICTED: pentatricopeptide repeat-containing protein At1g26460, mitochondrial-like isoform X1 [Citrus sinensis] Length = 613 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/46 (52%), Positives = 36/46 (78%) Frame = +1 Query: 1 LRKIRRRCAREMDHEADGKVVDLARQLKVIMRSEKRKNILFDIQYS 138 L+K+RRRC REMD E++ +V LA++ + M +E RKNILF+++YS Sbjct: 564 LKKVRRRCVREMDEESNDRVEALAKKFDIRMNTENRKNILFNLEYS 609 >ref|XP_006348701.1| PREDICTED: pentatricopeptide repeat-containing protein At1g26460, mitochondrial-like [Solanum tuberosum] Length = 617 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/48 (47%), Positives = 38/48 (79%) Frame = +1 Query: 1 LRKIRRRCAREMDHEADGKVVDLARQLKVIMRSEKRKNILFDIQYSGE 144 L+KIRRRC REMD+E+D +V +L ++ + M +E R+N+LF+++Y+ E Sbjct: 567 LKKIRRRCTREMDYESDDRVEELTKKFNIRMGTENRRNMLFNLRYNME 614 >ref|XP_004239056.1| PREDICTED: pentatricopeptide repeat-containing protein At1g26460, mitochondrial-like [Solanum lycopersicum] Length = 617 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/48 (47%), Positives = 38/48 (79%) Frame = +1 Query: 1 LRKIRRRCAREMDHEADGKVVDLARQLKVIMRSEKRKNILFDIQYSGE 144 L+KIRRRC REMD+E+D +V +L ++ + M +E R+N+LF+++Y+ E Sbjct: 567 LKKIRRRCTREMDYESDDRVEELTKKFNIRMGAENRRNMLFNLRYNME 614 >ref|NP_564247.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75173405|sp|Q9FZD1.1|PPR58_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g26460, mitochondrial; Flags: Precursor gi|9797754|gb|AAF98572.1|AC013427_15 Contains similarity to a hypothetical protein F21B7.16 gi|7485908 from Arabidopsis thaliana BAC F21B7 gb|AC002560 and contains multiple PPR PF|01535 repeats and a domain of unknown function PF|00668. ESTs gb|T45755, gb|AI993167, gb|AV554476, gb|T46823, gb|T41981, gb|AV546597, gb|AI099868 come from this gene [Arabidopsis thaliana] gi|19698979|gb|AAL91225.1| unknown protein [Arabidopsis thaliana] gi|22136300|gb|AAM91228.1| unknown protein [Arabidopsis thaliana] gi|332192573|gb|AEE30694.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 630 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/53 (52%), Positives = 38/53 (71%), Gaps = 1/53 (1%) Frame = +1 Query: 1 LRKIRRRCAREMDHEADGKVVDLARQLKVIMRSEKRKNILFDIQYS-GENTNN 156 L+K+RRRC REMD E D +V LA++ ++ M SE R+N+LF+I YS G NN Sbjct: 578 LKKLRRRCVREMDDENDDQVEALAKKFQIRMGSENRRNMLFNIDYSRGRALNN 630 >gb|AAM61409.1| unknown [Arabidopsis thaliana] Length = 630 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/53 (52%), Positives = 38/53 (71%), Gaps = 1/53 (1%) Frame = +1 Query: 1 LRKIRRRCAREMDHEADGKVVDLARQLKVIMRSEKRKNILFDIQYS-GENTNN 156 L+K+RRRC REMD E D +V LA++ ++ M SE R+N+LF+I YS G NN Sbjct: 578 LKKLRRRCVREMDDENDDQVEALAKKFQIRMGSENRRNMLFNIDYSRGRALNN 630 >ref|XP_006303169.1| hypothetical protein CARUB_v10008572mg [Capsella rubella] gi|482571880|gb|EOA36067.1| hypothetical protein CARUB_v10008572mg [Capsella rubella] Length = 630 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/53 (50%), Positives = 39/53 (73%), Gaps = 1/53 (1%) Frame = +1 Query: 1 LRKIRRRCAREMDHEADGKVVDLARQLKVIMRSEKRKNILFDIQYS-GENTNN 156 L+K+RRRC REMD+E D +V LA++ ++ M +E R+N+LF+I YS G NN Sbjct: 578 LKKLRRRCVREMDNENDDQVEALAKKFQIRMGTENRRNMLFNIDYSRGRALNN 630