BLASTX nr result
ID: Mentha26_contig00036677
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00036677 (340 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275275.1| PREDICTED: probably inactive leucine-rich re... 105 6e-21 emb|CAN76686.1| hypothetical protein VITISV_005469 [Vitis vinifera] 105 6e-21 ref|XP_007011288.1| Leucine-rich repeat protein kinase family pr... 104 1e-20 emb|CBI25352.3| unnamed protein product [Vitis vinifera] 104 1e-20 ref|XP_007220278.1| hypothetical protein PRUPE_ppa000889mg [Prun... 103 2e-20 ref|XP_007136420.1| hypothetical protein PHAVU_009G043600g [Phas... 102 4e-20 ref|XP_003522510.2| PREDICTED: probably inactive leucine-rich re... 101 9e-20 ref|NP_001239730.1| probably inactive leucine-rich repeat recept... 101 9e-20 gb|EXB96537.1| Probably inactive leucine-rich repeat receptor-li... 100 2e-19 ref|XP_006358746.1| PREDICTED: probably inactive leucine-rich re... 100 2e-19 ref|XP_006357297.1| PREDICTED: probably inactive leucine-rich re... 100 2e-19 ref|XP_004308984.1| PREDICTED: probably inactive leucine-rich re... 100 4e-19 ref|XP_004173348.1| PREDICTED: probably inactive leucine-rich re... 99 5e-19 ref|XP_004138394.1| PREDICTED: probably inactive leucine-rich re... 99 5e-19 ref|XP_006486161.1| PREDICTED: probably inactive leucine-rich re... 99 6e-19 ref|XP_006435929.1| hypothetical protein CICLE_v10030625mg [Citr... 99 6e-19 ref|XP_002520879.1| ATP binding protein, putative [Ricinus commu... 98 1e-18 ref|XP_002319878.2| leucine-rich repeat transmembrane protein ki... 97 3e-18 ref|XP_004240861.1| PREDICTED: probably inactive leucine-rich re... 96 7e-18 ref|XP_004246289.1| PREDICTED: probably inactive leucine-rich re... 95 1e-17 >ref|XP_002275275.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Vitis vinifera] Length = 969 Score = 105 bits (262), Expect = 6e-21 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = +1 Query: 1 GRLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSESQDEL 159 GRLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSE Q+EL Sbjct: 916 GRLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSEGQEEL 968 >emb|CAN76686.1| hypothetical protein VITISV_005469 [Vitis vinifera] Length = 167 Score = 105 bits (262), Expect = 6e-21 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = +1 Query: 1 GRLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSESQDEL 159 GRLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSE Q+EL Sbjct: 114 GRLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSEGQEEL 166 >ref|XP_007011288.1| Leucine-rich repeat protein kinase family protein [Theobroma cacao] gi|508728201|gb|EOY20098.1| Leucine-rich repeat protein kinase family protein [Theobroma cacao] Length = 982 Score = 104 bits (259), Expect = 1e-20 Identities = 49/54 (90%), Positives = 52/54 (96%) Frame = +1 Query: 1 GRLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSESQDELG 162 GRLQGKFPAEEAIPVMKLGLICTSQVPSNRPDM EVVNILELIRCPSE Q+++G Sbjct: 929 GRLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILELIRCPSEGQEDMG 982 >emb|CBI25352.3| unnamed protein product [Vitis vinifera] Length = 847 Score = 104 bits (259), Expect = 1e-20 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = +1 Query: 1 GRLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSESQDEL 159 GRLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSE Q++L Sbjct: 723 GRLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSEGQEDL 775 >ref|XP_007220278.1| hypothetical protein PRUPE_ppa000889mg [Prunus persica] gi|462416740|gb|EMJ21477.1| hypothetical protein PRUPE_ppa000889mg [Prunus persica] Length = 969 Score = 103 bits (257), Expect = 2e-20 Identities = 50/53 (94%), Positives = 51/53 (96%) Frame = +1 Query: 1 GRLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSESQDEL 159 GRLQG FPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSE Q+EL Sbjct: 917 GRLQGNFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSEGQEEL 969 >ref|XP_007136420.1| hypothetical protein PHAVU_009G043600g [Phaseolus vulgaris] gi|561009507|gb|ESW08414.1| hypothetical protein PHAVU_009G043600g [Phaseolus vulgaris] Length = 954 Score = 102 bits (255), Expect = 4e-20 Identities = 49/53 (92%), Positives = 51/53 (96%) Frame = +1 Query: 4 RLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSESQDELG 162 RL+GKFPAEEAIPVMKLGLICTSQVPSNRPDM EVVNILELIRCPSE Q+ELG Sbjct: 902 RLEGKFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILELIRCPSEGQEELG 954 >ref|XP_003522510.2| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Glycine max] Length = 978 Score = 101 bits (252), Expect = 9e-20 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = +1 Query: 4 RLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSESQDEL 159 RLQGKFPAEEAIPVMKLGLICTSQVPSNRPDM EVVNILELIRCPSE Q+EL Sbjct: 926 RLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILELIRCPSEGQEEL 977 >ref|NP_001239730.1| probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like precursor [Glycine max] gi|223452530|gb|ACM89592.1| leucine-rich repeat transmembrane protein kinase [Glycine max] Length = 971 Score = 101 bits (252), Expect = 9e-20 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = +1 Query: 4 RLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSESQDEL 159 RLQGKFPAEEAIPVMKLGLICTSQVPSNRPDM EVVNILELIRCPSE Q+EL Sbjct: 919 RLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILELIRCPSEGQEEL 970 >gb|EXB96537.1| Probably inactive leucine-rich repeat receptor-like protein kinase [Morus notabilis] Length = 978 Score = 100 bits (250), Expect = 2e-19 Identities = 48/55 (87%), Positives = 50/55 (90%) Frame = +1 Query: 4 RLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSESQDELGES 168 RL GKFPAEEAIP MKLGLICTSQVPSNRPDM EVVNILELIRCPSE Q+ELG + Sbjct: 924 RLHGKFPAEEAIPAMKLGLICTSQVPSNRPDMGEVVNILELIRCPSEDQEELGSN 978 >ref|XP_006358746.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Solanum tuberosum] Length = 894 Score = 100 bits (249), Expect = 2e-19 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = +1 Query: 4 RLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSESQDEL 159 RLQGKFPA+E IPVMKLGLICTSQVPSNRPDM EVVNILELIRCPSE QDEL Sbjct: 842 RLQGKFPADEVIPVMKLGLICTSQVPSNRPDMGEVVNILELIRCPSEGQDEL 893 >ref|XP_006357297.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Solanum tuberosum] Length = 971 Score = 100 bits (249), Expect = 2e-19 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +1 Query: 4 RLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSESQDEL 159 RL GKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILE+IRCPSE Q+EL Sbjct: 919 RLHGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILEMIRCPSEGQEEL 970 >ref|XP_004308984.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Fragaria vesca subsp. vesca] Length = 969 Score = 99.8 bits (247), Expect = 4e-19 Identities = 48/53 (90%), Positives = 49/53 (92%) Frame = +1 Query: 4 RLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSESQDELG 162 RLQG FPAEEAIPVMKLGLICTSQVPSNRPDM EVVNILELIRCPSE Q+E G Sbjct: 917 RLQGSFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILELIRCPSEGQEESG 969 >ref|XP_004173348.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Cucumis sativus] Length = 964 Score = 99.4 bits (246), Expect = 5e-19 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = +1 Query: 1 GRLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSESQDELG 162 GRLQ FP EEAIPV+KLGLICTSQVPSNRPDMAEVVNILELIRCPSE Q+ELG Sbjct: 911 GRLQRNFPLEEAIPVVKLGLICTSQVPSNRPDMAEVVNILELIRCPSEGQEELG 964 >ref|XP_004138394.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Cucumis sativus] Length = 964 Score = 99.4 bits (246), Expect = 5e-19 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = +1 Query: 1 GRLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSESQDELG 162 GRLQ FP EEAIPV+KLGLICTSQVPSNRPDMAEVVNILELIRCPSE Q+ELG Sbjct: 911 GRLQRNFPLEEAIPVVKLGLICTSQVPSNRPDMAEVVNILELIRCPSEGQEELG 964 >ref|XP_006486161.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Citrus sinensis] Length = 975 Score = 99.0 bits (245), Expect = 6e-19 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = +1 Query: 4 RLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSESQDEL 159 +LQGKFP+EEAIPVMKLGLICTSQVPSNRPDM EVVNILELIRCPSE Q+EL Sbjct: 923 KLQGKFPSEEAIPVMKLGLICTSQVPSNRPDMEEVVNILELIRCPSEGQEEL 974 >ref|XP_006435929.1| hypothetical protein CICLE_v10030625mg [Citrus clementina] gi|557538125|gb|ESR49169.1| hypothetical protein CICLE_v10030625mg [Citrus clementina] Length = 997 Score = 99.0 bits (245), Expect = 6e-19 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = +1 Query: 4 RLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSESQDEL 159 +LQGKFP+EEAIPVMKLGLICTSQVPSNRPDM EVVNILELIRCPSE Q+EL Sbjct: 945 KLQGKFPSEEAIPVMKLGLICTSQVPSNRPDMEEVVNILELIRCPSEGQEEL 996 >ref|XP_002520879.1| ATP binding protein, putative [Ricinus communis] gi|223540010|gb|EEF41588.1| ATP binding protein, putative [Ricinus communis] Length = 963 Score = 98.2 bits (243), Expect = 1e-18 Identities = 46/52 (88%), Positives = 48/52 (92%) Frame = +1 Query: 4 RLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSESQDEL 159 RLQG FPA+E +PVMKLGLICTSQVPSNRPDM EVVNILELIRCPSE QDEL Sbjct: 911 RLQGNFPADEVVPVMKLGLICTSQVPSNRPDMGEVVNILELIRCPSEGQDEL 962 >ref|XP_002319878.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] gi|550325354|gb|EEE95801.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] Length = 965 Score = 96.7 bits (239), Expect = 3e-18 Identities = 45/54 (83%), Positives = 49/54 (90%) Frame = +1 Query: 1 GRLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSESQDELG 162 GRL G FPA+EA+PVMKLGLICTSQVPSNRPDM EVVNIL+LIRCPSE Q+E G Sbjct: 912 GRLLGNFPADEAVPVMKLGLICTSQVPSNRPDMGEVVNILDLIRCPSEGQEESG 965 >ref|XP_004240861.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Solanum lycopersicum] Length = 894 Score = 95.5 bits (236), Expect = 7e-18 Identities = 46/52 (88%), Positives = 48/52 (92%) Frame = +1 Query: 4 RLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSESQDEL 159 R+QGKFPA+E IPVMKLGLICTSQVPSNRPDM EVVNILELIR PSE QDEL Sbjct: 842 RMQGKFPADEVIPVMKLGLICTSQVPSNRPDMGEVVNILELIRYPSEGQDEL 893 >ref|XP_004246289.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Solanum lycopersicum] Length = 965 Score = 94.7 bits (234), Expect = 1e-17 Identities = 44/53 (83%), Positives = 48/53 (90%) Frame = +1 Query: 1 GRLQGKFPAEEAIPVMKLGLICTSQVPSNRPDMAEVVNILELIRCPSESQDEL 159 GRLQG FP EEAIPV+KLGLIC SQVPSNRPDM EV+ ILELIRCPSESQ+E+ Sbjct: 912 GRLQGNFPVEEAIPVVKLGLICASQVPSNRPDMEEVIKILELIRCPSESQEEI 964