BLASTX nr result
ID: Mentha26_contig00036620
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00036620 (301 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36307.1| hypothetical protein MIMGU_mgv1a001495mg [Mimulus... 70 2e-10 ref|XP_002320787.2| hypothetical protein POPTR_0014s02800g [Popu... 70 4e-10 ref|XP_002510207.1| fms interacting protein, putative [Ricinus c... 70 4e-10 ref|XP_006473316.1| PREDICTED: THO complex subunit 5 homolog [Ci... 69 9e-10 ref|XP_006434752.1| hypothetical protein CICLE_v10000290mg [Citr... 69 9e-10 ref|XP_006354874.1| PREDICTED: THO complex subunit 5 homolog [So... 68 1e-09 gb|EXC32854.1| hypothetical protein L484_009554 [Morus notabilis] 68 2e-09 ref|XP_007017212.1| THO complex subunit 5 B [Theobroma cacao] gi... 68 2e-09 ref|XP_007225268.1| hypothetical protein PRUPE_ppa001502mg [Prun... 68 2e-09 emb|CBI19511.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_002284804.1| PREDICTED: THO complex subunit 5 homolog [Vi... 67 2e-09 ref|XP_004291099.1| PREDICTED: THO complex subunit 5 homolog B-l... 67 3e-09 ref|XP_006403327.1| hypothetical protein EUTSA_v10003147mg [Eutr... 67 3e-09 ref|XP_006842964.1| hypothetical protein AMTR_s00076p00023200 [A... 67 3e-09 ref|XP_004238149.1| PREDICTED: THO complex subunit 5 homolog [So... 66 6e-09 ref|XP_006280019.1| hypothetical protein CARUB_v10025894mg [Caps... 65 1e-08 ref|NP_974873.1| THO complex, subunit 5 [Arabidopsis thaliana] g... 65 1e-08 ref|NP_568616.1| THO complex, subunit 5 [Arabidopsis thaliana] g... 65 1e-08 ref|XP_002863717.1| hypothetical protein ARALYDRAFT_494728 [Arab... 64 2e-08 ref|XP_004166694.1| PREDICTED: THO complex subunit 5 homolog [Cu... 62 6e-08 >gb|EYU36307.1| hypothetical protein MIMGU_mgv1a001495mg [Mimulus guttatus] Length = 808 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +3 Query: 3 LCKPVTGKLITRSFRGRDRRKMISWKERSCTSGYPY 110 LCKPV+G L++RSFRGRDRRKMISWKE CTSGYPY Sbjct: 773 LCKPVSGGLVSRSFRGRDRRKMISWKENICTSGYPY 808 >ref|XP_002320787.2| hypothetical protein POPTR_0014s02800g [Populus trichocarpa] gi|550323238|gb|EEE99102.2| hypothetical protein POPTR_0014s02800g [Populus trichocarpa] Length = 797 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +3 Query: 3 LCKPVTGKLITRSFRGRDRRKMISWKERSCTSGYPY 110 LCKPV+G L+ RSFRGRDRRKMISWK+ CTSGYPY Sbjct: 762 LCKPVSGSLLARSFRGRDRRKMISWKDMECTSGYPY 797 >ref|XP_002510207.1| fms interacting protein, putative [Ricinus communis] gi|223550908|gb|EEF52394.1| fms interacting protein, putative [Ricinus communis] Length = 808 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +3 Query: 3 LCKPVTGKLITRSFRGRDRRKMISWKERSCTSGYPY 110 LCKPV G+L+ RSFRGRDRRKMISWK+ CTSGYPY Sbjct: 773 LCKPVIGRLLARSFRGRDRRKMISWKDMECTSGYPY 808 >ref|XP_006473316.1| PREDICTED: THO complex subunit 5 homolog [Citrus sinensis] Length = 823 Score = 68.6 bits (166), Expect = 9e-10 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +3 Query: 3 LCKPVTGKLITRSFRGRDRRKMISWKERSCTSGYPY 110 LCKPV+G+L+ RSFRGRDRRKMISWK+ CT GYPY Sbjct: 788 LCKPVSGRLLARSFRGRDRRKMISWKDMECTPGYPY 823 >ref|XP_006434752.1| hypothetical protein CICLE_v10000290mg [Citrus clementina] gi|557536874|gb|ESR47992.1| hypothetical protein CICLE_v10000290mg [Citrus clementina] Length = 823 Score = 68.6 bits (166), Expect = 9e-10 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +3 Query: 3 LCKPVTGKLITRSFRGRDRRKMISWKERSCTSGYPY 110 LCKPV+G+L+ RSFRGRDRRKMISWK+ CT GYPY Sbjct: 788 LCKPVSGRLLARSFRGRDRRKMISWKDMECTPGYPY 823 >ref|XP_006354874.1| PREDICTED: THO complex subunit 5 homolog [Solanum tuberosum] Length = 807 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +3 Query: 3 LCKPVTGKLITRSFRGRDRRKMISWKERSCTSGYPY 110 LCKP+TG+L+ RSFRGRD RKMISWK+ SCT GYPY Sbjct: 772 LCKPMTGELVARSFRGRDHRKMISWKDGSCTPGYPY 807 >gb|EXC32854.1| hypothetical protein L484_009554 [Morus notabilis] Length = 815 Score = 67.8 bits (164), Expect = 2e-09 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = +3 Query: 3 LCKPVTGKLITRSFRGRDRRKMISWKERSCTSGYPY 110 LCKPV+G+L++RS+RGRDRRKMISWK+ CT GYPY Sbjct: 780 LCKPVSGQLVSRSYRGRDRRKMISWKDMECTPGYPY 815 >ref|XP_007017212.1| THO complex subunit 5 B [Theobroma cacao] gi|508722540|gb|EOY14437.1| THO complex subunit 5 B [Theobroma cacao] Length = 842 Score = 67.8 bits (164), Expect = 2e-09 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = +3 Query: 3 LCKPVTGKLITRSFRGRDRRKMISWKERSCTSGYPY 110 LCKPV+G+L+ RSFRGRDRRKMISWK+ CT+GYP+ Sbjct: 807 LCKPVSGRLLARSFRGRDRRKMISWKDMECTTGYPF 842 >ref|XP_007225268.1| hypothetical protein PRUPE_ppa001502mg [Prunus persica] gi|462422204|gb|EMJ26467.1| hypothetical protein PRUPE_ppa001502mg [Prunus persica] Length = 813 Score = 67.8 bits (164), Expect = 2e-09 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +3 Query: 3 LCKPVTGKLITRSFRGRDRRKMISWKERSCTSGYPY 110 LCKPV G+L+ RSFRGRDRRKMISWK+ CT GYPY Sbjct: 778 LCKPVIGQLVARSFRGRDRRKMISWKDMECTPGYPY 813 >emb|CBI19511.3| unnamed protein product [Vitis vinifera] Length = 780 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +3 Query: 3 LCKPVTGKLITRSFRGRDRRKMISWKERSCTSGYPY 110 LCKPVTG+L+ RS RGRDRRKMISWK+ CT GYPY Sbjct: 745 LCKPVTGRLLARSVRGRDRRKMISWKDMECTPGYPY 780 >ref|XP_002284804.1| PREDICTED: THO complex subunit 5 homolog [Vitis vinifera] Length = 816 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +3 Query: 3 LCKPVTGKLITRSFRGRDRRKMISWKERSCTSGYPY 110 LCKPVTG+L+ RS RGRDRRKMISWK+ CT GYPY Sbjct: 781 LCKPVTGRLLARSVRGRDRRKMISWKDMECTPGYPY 816 >ref|XP_004291099.1| PREDICTED: THO complex subunit 5 homolog B-like [Fragaria vesca subsp. vesca] Length = 807 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +3 Query: 3 LCKPVTGKLITRSFRGRDRRKMISWKERSCTSGYPY 110 LCKPV+G+LI RSFRGRDRRKMISWK+ C GYPY Sbjct: 772 LCKPVSGQLIARSFRGRDRRKMISWKDMECNPGYPY 807 >ref|XP_006403327.1| hypothetical protein EUTSA_v10003147mg [Eutrema salsugineum] gi|557104440|gb|ESQ44780.1| hypothetical protein EUTSA_v10003147mg [Eutrema salsugineum] Length = 823 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 3 LCKPVTGKLITRSFRGRDRRKMISWKERSCTSGYP 107 LCKPV GKL+ RSFRGRD RKMISWK+R C SGYP Sbjct: 788 LCKPVDGKLLVRSFRGRDHRKMISWKDRECASGYP 822 >ref|XP_006842964.1| hypothetical protein AMTR_s00076p00023200 [Amborella trichopoda] gi|548845161|gb|ERN04639.1| hypothetical protein AMTR_s00076p00023200 [Amborella trichopoda] Length = 816 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +3 Query: 3 LCKPVTGKLITRSFRGRDRRKMISWKERSCTSGYPY 110 LCKPV GK+I RSFRGRDRR+MISWK R C GYPY Sbjct: 781 LCKPVGGKIIARSFRGRDRRRMISWKNRECVIGYPY 816 >ref|XP_004238149.1| PREDICTED: THO complex subunit 5 homolog [Solanum lycopersicum] Length = 808 Score = 65.9 bits (159), Expect = 6e-09 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +3 Query: 3 LCKPVTGKLITRSFRGRDRRKMISWKERSCTSGYPY 110 LCKP+TG+L+ RSFRGRD RKMISWK+ CT GYPY Sbjct: 773 LCKPMTGELVARSFRGRDHRKMISWKDGFCTPGYPY 808 >ref|XP_006280019.1| hypothetical protein CARUB_v10025894mg [Capsella rubella] gi|482548723|gb|EOA12917.1| hypothetical protein CARUB_v10025894mg [Capsella rubella] Length = 824 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 3 LCKPVTGKLITRSFRGRDRRKMISWKERSCTSGYP 107 LCKPV GKL+ RSFRGRD RKMISWK R C SGYP Sbjct: 789 LCKPVDGKLLVRSFRGRDHRKMISWKGRGCASGYP 823 >ref|NP_974873.1| THO complex, subunit 5 [Arabidopsis thaliana] gi|597502311|sp|F4K4J0.1|THO5B_ARATH RecName: Full=THO complex subunit 5B; AltName: Full=THO complex subunit 5; Short=AtTHO5 gi|332007505|gb|AED94888.1| THO complex, subunit 5 [Arabidopsis thaliana] Length = 819 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 3 LCKPVTGKLITRSFRGRDRRKMISWKERSCTSGYP 107 LCKPV GKL+ RSFRGRD RKMISWK R C SGYP Sbjct: 784 LCKPVDGKLLVRSFRGRDHRKMISWKGRGCASGYP 818 >ref|NP_568616.1| THO complex, subunit 5 [Arabidopsis thaliana] gi|14532602|gb|AAK64029.1| unknown protein [Arabidopsis thaliana] gi|20259139|gb|AAM14285.1| unknown protein [Arabidopsis thaliana] gi|332007504|gb|AED94887.1| THO complex, subunit 5 [Arabidopsis thaliana] Length = 702 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +3 Query: 3 LCKPVTGKLITRSFRGRDRRKMISWKERSCTSGYP 107 LCKPV GKL+ RSFRGRD RKMISWK R C SGYP Sbjct: 667 LCKPVDGKLLVRSFRGRDHRKMISWKGRGCASGYP 701 >ref|XP_002863717.1| hypothetical protein ARALYDRAFT_494728 [Arabidopsis lyrata subsp. lyrata] gi|297309552|gb|EFH39976.1| hypothetical protein ARALYDRAFT_494728 [Arabidopsis lyrata subsp. lyrata] Length = 815 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +3 Query: 3 LCKPVTGKLITRSFRGRDRRKMISWKERSCTSGYP 107 LCKPV GKL+ RSFRGRD RKMISWK + C SGYP Sbjct: 780 LCKPVDGKLLVRSFRGRDHRKMISWKGKGCASGYP 814 >ref|XP_004166694.1| PREDICTED: THO complex subunit 5 homolog [Cucumis sativus] Length = 815 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +3 Query: 3 LCKPVTGKLITRSFRGRDRRKMISWKERSCTSGYP 107 LCKPV+G L RSFRGRDRRKMISWK+ CT GYP Sbjct: 780 LCKPVSGSLHARSFRGRDRRKMISWKDIECTPGYP 814