BLASTX nr result
ID: Mentha26_contig00036611
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00036611 (359 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20418.1| hypothetical protein MIMGU_mgv1a000468mg [Mimulus... 61 2e-07 >gb|EYU20418.1| hypothetical protein MIMGU_mgv1a000468mg [Mimulus guttatus] gi|604300601|gb|EYU20419.1| hypothetical protein MIMGU_mgv1a000468mg [Mimulus guttatus] gi|604300602|gb|EYU20420.1| hypothetical protein MIMGU_mgv1a000468mg [Mimulus guttatus] gi|604300603|gb|EYU20421.1| hypothetical protein MIMGU_mgv1a000468mg [Mimulus guttatus] Length = 1130 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/46 (54%), Positives = 37/46 (80%) Frame = +1 Query: 151 RSTDDSSDDEAFHSSEQHQATQSNLKEDIDLHGGRMRRKVVFDHKM 288 +S D+SS++E F++SEQH QSN KE ID+H GR+RR+ VF+++M Sbjct: 409 KSIDESSEEETFYASEQHSPAQSNFKEQIDVHDGRVRRRAVFENEM 454