BLASTX nr result
ID: Mentha26_contig00036593
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00036593 (399 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27622.1| hypothetical protein MIMGU_mgv1a005242mg [Mimulus... 60 2e-07 >gb|EYU27622.1| hypothetical protein MIMGU_mgv1a005242mg [Mimulus guttatus] Length = 492 Score = 60.5 bits (145), Expect = 2e-07 Identities = 33/49 (67%), Positives = 37/49 (75%), Gaps = 3/49 (6%) Frame = -3 Query: 145 SRKFRRAAKKIFVQTCGSFCQTQQPHLDTSSATTA---SPNNCASSPEN 8 S K ++AAKKIFVQTCGSFCQTQ HL S+ATTA SP N +S PEN Sbjct: 9 SGKLKKAAKKIFVQTCGSFCQTQPSHLHNSTATTAWCDSP-NYSSPPEN 56