BLASTX nr result
ID: Mentha26_contig00036438
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00036438 (405 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42767.1| hypothetical protein MIMGU_mgv1a003398mg [Mimulus... 71 1e-10 >gb|EYU42767.1| hypothetical protein MIMGU_mgv1a003398mg [Mimulus guttatus] Length = 588 Score = 71.2 bits (173), Expect = 1e-10 Identities = 38/71 (53%), Positives = 44/71 (61%), Gaps = 4/71 (5%) Frame = -3 Query: 202 MAKLFSNPXXXXXXXXXXXXHNES----LCSSRKLTAFPNLGHFSKWVPKNFARIQLRSD 35 MAKL SNP HN++ LC SRK+ A P++ HFSKW P+ ARIQ R Sbjct: 1 MAKLLSNPCRNSSPATFSSYHNDNNYKNLCCSRKINALPSITHFSKWAPRILARIQTRRR 60 Query: 34 FELRSSNGYPL 2 FELRSSNGYPL Sbjct: 61 FELRSSNGYPL 71