BLASTX nr result
ID: Mentha26_contig00036315
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00036315 (570 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22582.1| hypothetical protein MIMGU_mgv1a007481mg [Mimulus... 58 2e-06 >gb|EYU22582.1| hypothetical protein MIMGU_mgv1a007481mg [Mimulus guttatus] Length = 406 Score = 57.8 bits (138), Expect = 2e-06 Identities = 36/84 (42%), Positives = 52/84 (61%), Gaps = 3/84 (3%) Frame = +1 Query: 16 NDHLDCELMEDVSGKFQELWEKAVSRRRKDI---HSGIKGHDSTPSNINKEPQNAESKNA 186 ND DC L+ED S + Q++WEKA +RRRK+I HS +K DST I+ QN E+ +A Sbjct: 162 NDLPDCVLVED-STELQQMWEKAFTRRRKNIPSGHSDVKDRDSTAHIIDDHHQNIETNDA 220 Query: 187 STHNKEASFFHTAEKPNKKIGSTS 258 S+ + A F ++PN + G +S Sbjct: 221 SSPFRSADDF---DRPNCEPGISS 241