BLASTX nr result
ID: Mentha26_contig00036090
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00036090 (547 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33640.1| hypothetical protein MIMGU_mgv1a002468mg [Mimulus... 60 3e-07 >gb|EYU33640.1| hypothetical protein MIMGU_mgv1a002468mg [Mimulus guttatus] Length = 670 Score = 60.5 bits (145), Expect = 3e-07 Identities = 41/108 (37%), Positives = 51/108 (47%), Gaps = 3/108 (2%) Frame = +2 Query: 176 MKVTVDKGVG-QQIQXXXXXXXXXXXXEKPSFQRKPLHXXXXXXXXXXXETGAPNAKRSS 352 MKVTV++ ++IQ EKP F RKP P+AKRSS Sbjct: 1 MKVTVERTTASREIQPPPNPPPPSDLSEKPIFPRKPPRRKTRAPGAGVRLKRDPSAKRSS 60 Query: 353 RPETPLLRWKFDVDN--EKNVAAEEEXXXXXXXXXXXXXNKAAVSSRK 490 RPETPLLRWKF+ N +V EEE ++A VS+RK Sbjct: 61 RPETPLLRWKFEEPNVQTNSVVEEEEKSSGEAGRKISRRSRAVVSARK 108