BLASTX nr result
ID: Mentha26_contig00035888
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00035888 (373 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44501.1| hypothetical protein MIMGU_mgv1a002053mg [Mimulus... 111 1e-22 gb|EYU44500.1| hypothetical protein MIMGU_mgv1a002053mg [Mimulus... 111 1e-22 ref|XP_004233609.1| PREDICTED: pentatricopeptide repeat-containi... 97 2e-18 ref|XP_006363825.1| PREDICTED: pentatricopeptide repeat-containi... 96 7e-18 ref|XP_003608531.1| Pentatricopeptide repeat-containing protein ... 86 7e-15 gb|EPS57255.1| hypothetical protein M569_17565, partial [Genlise... 84 3e-14 ref|XP_004509062.1| PREDICTED: pentatricopeptide repeat-containi... 83 3e-14 ref|XP_006279544.1| hypothetical protein CARUB_v10028435mg [Caps... 82 8e-14 ref|XP_004141982.1| PREDICTED: pentatricopeptide repeat-containi... 82 8e-14 ref|XP_002866697.1| EMB1408 [Arabidopsis lyrata subsp. lyrata] g... 81 1e-13 ref|NP_201558.3| pentatricopeptide repeat-containing protein del... 81 1e-13 ref|XP_006393964.1| hypothetical protein EUTSA_v10003664mg [Eutr... 80 2e-13 ref|XP_007047545.1| Tetratricopeptide repeat-like superfamily pr... 78 1e-12 ref|XP_006466446.1| PREDICTED: pentatricopeptide repeat-containi... 77 2e-12 ref|XP_007204940.1| hypothetical protein PRUPE_ppa001240mg [Prun... 77 2e-12 gb|EXB94039.1| hypothetical protein L484_009383 [Morus notabilis] 76 5e-12 ref|XP_006426111.1| hypothetical protein CICLE_v10027042mg [Citr... 73 4e-11 ref|XP_007155826.1| hypothetical protein PHAVU_003G234700g [Phas... 72 8e-11 ref|XP_003550974.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 ref|XP_002310894.2| hypothetical protein POPTR_0007s14930g [Popu... 69 5e-10 >gb|EYU44501.1| hypothetical protein MIMGU_mgv1a002053mg [Mimulus guttatus] Length = 685 Score = 111 bits (277), Expect = 1e-22 Identities = 56/93 (60%), Positives = 66/93 (70%) Frame = -1 Query: 283 MEASTAXXXXXXXXXXXXXXXKISRKLLQQGVHPTPKILHNLRKKELQKLNRRDAKQASK 104 MEAST KI +KLL+ GV PTP+ILHNLRKKE+QK NRR AKQ SK Sbjct: 1 MEASTGTPSSFPNPPPQPNLEKIKQKLLKYGVQPTPRILHNLRKKEIQKSNRRLAKQTSK 60 Query: 103 LPPPLTDVQKQTISEESHFQTIKSEYKKFTRNE 5 LPPPL+D Q++ + EESHF+TIK EY KFT+NE Sbjct: 61 LPPPLSDAQREAVLEESHFRTIKKEYNKFTKNE 93 >gb|EYU44500.1| hypothetical protein MIMGU_mgv1a002053mg [Mimulus guttatus] Length = 721 Score = 111 bits (277), Expect = 1e-22 Identities = 56/93 (60%), Positives = 66/93 (70%) Frame = -1 Query: 283 MEASTAXXXXXXXXXXXXXXXKISRKLLQQGVHPTPKILHNLRKKELQKLNRRDAKQASK 104 MEAST KI +KLL+ GV PTP+ILHNLRKKE+QK NRR AKQ SK Sbjct: 1 MEASTGTPSSFPNPPPQPNLEKIKQKLLKYGVQPTPRILHNLRKKEIQKSNRRLAKQTSK 60 Query: 103 LPPPLTDVQKQTISEESHFQTIKSEYKKFTRNE 5 LPPPL+D Q++ + EESHF+TIK EY KFT+NE Sbjct: 61 LPPPLSDAQREAVLEESHFRTIKKEYNKFTKNE 93 >ref|XP_004233609.1| PREDICTED: pentatricopeptide repeat-containing protein At5g67570, chloroplastic-like [Solanum lycopersicum] Length = 1092 Score = 97.1 bits (240), Expect = 2e-18 Identities = 45/69 (65%), Positives = 56/69 (81%) Frame = -1 Query: 217 ISRKLLQQGVHPTPKILHNLRKKELQKLNRRDAKQASKLPPPLTDVQKQTISEESHFQTI 38 + + LLQ+GV PTPKI+H LR KELQK NRR AK+A+K PPPLTD QKQ ++EES+FQ + Sbjct: 243 LKQNLLQKGVDPTPKIIHTLRIKELQKFNRRLAKKAAKEPPPLTDTQKQALAEESYFQAV 302 Query: 37 KSEYKKFTR 11 KSEYK F + Sbjct: 303 KSEYKSFKK 311 >ref|XP_006363825.1| PREDICTED: pentatricopeptide repeat-containing protein At5g67570, chloroplastic-like [Solanum tuberosum] Length = 864 Score = 95.5 bits (236), Expect = 7e-18 Identities = 44/69 (63%), Positives = 55/69 (79%) Frame = -1 Query: 217 ISRKLLQQGVHPTPKILHNLRKKELQKLNRRDAKQASKLPPPLTDVQKQTISEESHFQTI 38 + + LLQ+GV PTPKI+H LR KELQK NRR K+A+K PPPLTD QKQ ++EES+FQ + Sbjct: 22 LKQNLLQKGVDPTPKIIHTLRIKELQKFNRRLTKKAAKEPPPLTDTQKQALAEESYFQAV 81 Query: 37 KSEYKKFTR 11 KSEYK F + Sbjct: 82 KSEYKSFKK 90 >ref|XP_003608531.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355509586|gb|AES90728.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 877 Score = 85.5 bits (210), Expect = 7e-15 Identities = 41/70 (58%), Positives = 55/70 (78%) Frame = -1 Query: 217 ISRKLLQQGVHPTPKILHNLRKKELQKLNRRDAKQASKLPPPLTDVQKQTISEESHFQTI 38 I R L+Q+GV PTPKI+H LRKK++QK NR+ +Q ++L PPL+ QKQT+ EE HFQ + Sbjct: 27 IRRSLIQKGVTPTPKIIHTLRKKQIQKHNRKLNRQ-NQLNPPLSKSQKQTLEEEQHFQEL 85 Query: 37 KSEYKKFTRN 8 K EYK+FT+N Sbjct: 86 KHEYKQFTQN 95 >gb|EPS57255.1| hypothetical protein M569_17565, partial [Genlisea aurea] Length = 399 Score = 83.6 bits (205), Expect = 3e-14 Identities = 46/92 (50%), Positives = 62/92 (67%), Gaps = 3/92 (3%) Frame = -1 Query: 283 MEASTAXXXXXXXXXXXXXXXKISRKLLQQGV-HPTPKILHNLRKKELQKLNRRDAKQAS 107 MEAS+ K+ KL+++GV P+P+I+HNLR KE+QK NRR AK+A+ Sbjct: 1 MEASSIGPLNLPPQPFVPNLEKVRDKLVKRGVLQPSPRIIHNLRNKEIQKFNRRQAKEAA 60 Query: 106 --KLPPPLTDVQKQTISEESHFQTIKSEYKKF 17 KLPP +D Q++ I+EESHFQ IKSEY+KF Sbjct: 61 AKKLPPLPSDAQRREIAEESHFQLIKSEYRKF 92 >ref|XP_004509062.1| PREDICTED: pentatricopeptide repeat-containing protein At5g67570, chloroplastic-like [Cicer arietinum] Length = 883 Score = 83.2 bits (204), Expect = 3e-14 Identities = 39/69 (56%), Positives = 54/69 (78%) Frame = -1 Query: 217 ISRKLLQQGVHPTPKILHNLRKKELQKLNRRDAKQASKLPPPLTDVQKQTISEESHFQTI 38 I R L+Q+GV+PTPKI+H LRKK++QK NR+ +QA PPL++ QKQT+ EE HFQ + Sbjct: 26 IRRNLIQKGVNPTPKIIHTLRKKQIQKHNRKLNRQALN-SPPLSNSQKQTMKEEHHFQEL 84 Query: 37 KSEYKKFTR 11 K EY++FT+ Sbjct: 85 KDEYRRFTK 93 >ref|XP_006279544.1| hypothetical protein CARUB_v10028435mg [Capsella rubella] gi|482548248|gb|EOA12442.1| hypothetical protein CARUB_v10028435mg [Capsella rubella] Length = 801 Score = 82.0 bits (201), Expect = 8e-14 Identities = 39/69 (56%), Positives = 51/69 (73%) Frame = -1 Query: 217 ISRKLLQQGVHPTPKILHNLRKKELQKLNRRDAKQASKLPPPLTDVQKQTISEESHFQTI 38 I R+LL+ GV PTPKIL+NLRKKE+QK NRR ++ T+ QKQ++ EE+ FQT+ Sbjct: 26 IKRRLLKYGVDPTPKILNNLRKKEIQKHNRRTKRETESEAEVYTEAQKQSMEEEARFQTL 85 Query: 37 KSEYKKFTR 11 K EYK+FTR Sbjct: 86 KREYKQFTR 94 >ref|XP_004141982.1| PREDICTED: pentatricopeptide repeat-containing protein At5g67570, chloroplastic-like [Cucumis sativus] gi|449499902|ref|XP_004160949.1| PREDICTED: pentatricopeptide repeat-containing protein At5g67570, chloroplastic-like [Cucumis sativus] Length = 860 Score = 82.0 bits (201), Expect = 8e-14 Identities = 40/72 (55%), Positives = 57/72 (79%), Gaps = 3/72 (4%) Frame = -1 Query: 217 ISRKLLQQGVHPTPKILHNLRKKELQKLNR---RDAKQASKLPPPLTDVQKQTISEESHF 47 I R LLQ+GV+PTP+I+ +LRKKE+QK NR R A++ S PPL++ QKQ I+EE+HF Sbjct: 22 IKRMLLQKGVYPTPRIVRSLRKKEIQKYNRKLKRVAERQSAQSPPLSESQKQLIAEETHF 81 Query: 46 QTIKSEYKKFTR 11 T++SEYK+F++ Sbjct: 82 LTLRSEYKEFSK 93 >ref|XP_002866697.1| EMB1408 [Arabidopsis lyrata subsp. lyrata] gi|297312532|gb|EFH42956.1| EMB1408 [Arabidopsis lyrata subsp. lyrata] Length = 621 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/70 (54%), Positives = 52/70 (74%) Frame = -1 Query: 217 ISRKLLQQGVHPTPKILHNLRKKELQKLNRRDAKQASKLPPPLTDVQKQTISEESHFQTI 38 I R+LL+ GV PTPKIL+NLRKKE+QK NRR ++ T+ QKQ++ EE+ FQT+ Sbjct: 26 IKRRLLKYGVDPTPKILNNLRKKEIQKHNRRTKRETESEAEVYTEAQKQSMEEEARFQTL 85 Query: 37 KSEYKKFTRN 8 + EYK+FTR+ Sbjct: 86 RREYKQFTRS 95 >ref|NP_201558.3| pentatricopeptide repeat-containing protein delayed greening 1 [Arabidopsis thaliana] gi|223635752|sp|Q9FJW6.2|PP451_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g67570, chloroplastic; AltName: Full=Protein DELAYED GREENING 1; AltName: Full=Protein EMBRYO DEFECTIVE 1408; Flags: Precursor gi|332010978|gb|AED98361.1| pentatricopeptide repeat-containing protein delayed greening 1 [Arabidopsis thaliana] Length = 798 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/70 (54%), Positives = 52/70 (74%) Frame = -1 Query: 217 ISRKLLQQGVHPTPKILHNLRKKELQKLNRRDAKQASKLPPPLTDVQKQTISEESHFQTI 38 I R+LL+ GV PTPKIL+NLRKKE+QK NRR ++ T+ QKQ++ EE+ FQT+ Sbjct: 26 IKRRLLKYGVDPTPKILNNLRKKEIQKHNRRTKRETESEAEVYTEAQKQSMEEEARFQTL 85 Query: 37 KSEYKKFTRN 8 + EYK+FTR+ Sbjct: 86 RREYKQFTRS 95 >ref|XP_006393964.1| hypothetical protein EUTSA_v10003664mg [Eutrema salsugineum] gi|557090603|gb|ESQ31250.1| hypothetical protein EUTSA_v10003664mg [Eutrema salsugineum] Length = 811 Score = 80.5 bits (197), Expect = 2e-13 Identities = 40/72 (55%), Positives = 52/72 (72%), Gaps = 3/72 (4%) Frame = -1 Query: 217 ISRKLLQQGVHPTPKILHNLRKKELQKLNRRDAKQA---SKLPPPLTDVQKQTISEESHF 47 I RKLL+ GV PTPKIL NL+KKE+QK NR+ +Q + T+ QKQ+I EE+HF Sbjct: 26 IKRKLLKYGVDPTPKILRNLQKKEIQKHNRKTKRQVESEGETSQVYTEAQKQSIEEEAHF 85 Query: 46 QTIKSEYKKFTR 11 QT++ EYK+FTR Sbjct: 86 QTVRREYKQFTR 97 >ref|XP_007047545.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508699806|gb|EOX91702.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] Length = 897 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/69 (53%), Positives = 52/69 (75%) Frame = -1 Query: 217 ISRKLLQQGVHPTPKILHNLRKKELQKLNRRDAKQASKLPPPLTDVQKQTISEESHFQTI 38 I RKLL++GV+PTPKI+ LRK+E+QK + R K + PPLT Q Q+++EESHF T+ Sbjct: 23 IKRKLLRKGVYPTPKIIRTLRKREIQK-HTRKTKHSQPQTPPLTAFQLQSLAEESHFLTL 81 Query: 37 KSEYKKFTR 11 K EYK+F++ Sbjct: 82 KREYKRFSK 90 >ref|XP_006466446.1| PREDICTED: pentatricopeptide repeat-containing protein At5g67570, chloroplastic-like [Citrus sinensis] Length = 901 Score = 77.4 bits (189), Expect = 2e-12 Identities = 39/69 (56%), Positives = 51/69 (73%) Frame = -1 Query: 217 ISRKLLQQGVHPTPKILHNLRKKELQKLNRRDAKQASKLPPPLTDVQKQTISEESHFQTI 38 I +KLL+ GV PTPKIL ++RKKE+QK NR+ AK S+ PLT Q+Q ++EE HFQT+ Sbjct: 25 IKQKLLKHGVFPTPKILRSIRKKEIQKHNRKQAKIQSQ--APLTPSQEQALAEEQHFQTL 82 Query: 37 KSEYKKFTR 11 K E+K F R Sbjct: 83 KREFKMFHR 91 >ref|XP_007204940.1| hypothetical protein PRUPE_ppa001240mg [Prunus persica] gi|462400582|gb|EMJ06139.1| hypothetical protein PRUPE_ppa001240mg [Prunus persica] Length = 874 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/71 (52%), Positives = 52/71 (73%), Gaps = 2/71 (2%) Frame = -1 Query: 217 ISRKLLQQGVHPTPKILHNLRKKELQKLNRRDAKQASKLP--PPLTDVQKQTISEESHFQ 44 I R+L GV+PTPKI+H +RKKE+QK NR+ + A P PPL+ QKQ +++E+HFQ Sbjct: 23 IKRRLNNGGVYPTPKIVHTIRKKEIQKHNRKLNRLAKADPSSPPLSQSQKQALADETHFQ 82 Query: 43 TIKSEYKKFTR 11 T+K EY+ FT+ Sbjct: 83 TLKREYRDFTK 93 >gb|EXB94039.1| hypothetical protein L484_009383 [Morus notabilis] Length = 910 Score = 75.9 bits (185), Expect = 5e-12 Identities = 38/69 (55%), Positives = 49/69 (71%) Frame = -1 Query: 217 ISRKLLQQGVHPTPKILHNLRKKELQKLNRRDAKQASKLPPPLTDVQKQTISEESHFQTI 38 I R LL++GV PTPKI+H LRKKE QK NR+ + A LT+ QKQ ++E+SHFQT+ Sbjct: 22 IKRNLLKKGVDPTPKIVHTLRKKEFQKHNRKAKRLAYN--QSLTESQKQALAEQSHFQTL 79 Query: 37 KSEYKKFTR 11 + EYK F R Sbjct: 80 RREYKDFNR 88 >ref|XP_006426111.1| hypothetical protein CICLE_v10027042mg [Citrus clementina] gi|557528101|gb|ESR39351.1| hypothetical protein CICLE_v10027042mg [Citrus clementina] Length = 900 Score = 73.2 bits (178), Expect = 4e-11 Identities = 37/69 (53%), Positives = 50/69 (72%) Frame = -1 Query: 217 ISRKLLQQGVHPTPKILHNLRKKELQKLNRRDAKQASKLPPPLTDVQKQTISEESHFQTI 38 I +KLL+ GV PTPKIL ++RKKE+QK NR+ AK S+ L+ Q+Q ++EE HFQT+ Sbjct: 25 IKQKLLKHGVFPTPKILRSIRKKEIQKHNRKQAKIQSQ--AQLSPSQQQALAEEQHFQTL 82 Query: 37 KSEYKKFTR 11 K E+K F R Sbjct: 83 KREFKMFRR 91 >ref|XP_007155826.1| hypothetical protein PHAVU_003G234700g [Phaseolus vulgaris] gi|561029180|gb|ESW27820.1| hypothetical protein PHAVU_003G234700g [Phaseolus vulgaris] Length = 870 Score = 72.0 bits (175), Expect = 8e-11 Identities = 35/66 (53%), Positives = 47/66 (71%) Frame = -1 Query: 217 ISRKLLQQGVHPTPKILHNLRKKELQKLNRRDAKQASKLPPPLTDVQKQTISEESHFQTI 38 I RKL+Q+GV PTPKI+H LR KE+QK NR K S+ PPPLT + Q ++E+ HF I Sbjct: 23 IRRKLIQKGVDPTPKIVHILRNKEIQKHNR---KLKSQPPPPLTPAEAQALAEDQHFHVI 79 Query: 37 KSEYKK 20 K E+++ Sbjct: 80 KREFRE 85 >ref|XP_003550974.1| PREDICTED: pentatricopeptide repeat-containing protein At5g67570, chloroplastic-like [Glycine max] Length = 865 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/66 (51%), Positives = 47/66 (71%) Frame = -1 Query: 217 ISRKLLQQGVHPTPKILHNLRKKELQKLNRRDAKQASKLPPPLTDVQKQTISEESHFQTI 38 I R+L+++GV PTPKI+H LRKKE+QK NR+ Q + PPLT Q Q +EE H +TI Sbjct: 23 IRRRLIEKGVQPTPKIVHTLRKKEIQKHNRKLKAQPA---PPLTQAQAQAAAEEQHLETI 79 Query: 37 KSEYKK 20 K E+++ Sbjct: 80 KREFRR 85 >ref|XP_002310894.2| hypothetical protein POPTR_0007s14930g [Populus trichocarpa] gi|550334917|gb|EEE91344.2| hypothetical protein POPTR_0007s14930g [Populus trichocarpa] Length = 879 Score = 69.3 bits (168), Expect = 5e-10 Identities = 36/72 (50%), Positives = 49/72 (68%), Gaps = 3/72 (4%) Frame = -1 Query: 217 ISRKLLQQGVHPTPKILHNLRKKELQKLNRRDAKQASKLPPPLTDVQKQ---TISEESHF 47 I R+LL++GV+PTPKI+HNLRKKE+QK NR+ K + Q+Q + EESHF Sbjct: 22 IKRRLLKRGVYPTPKIVHNLRKKEIQKHNRKLNKD--------VEFQRQALFVLEEESHF 73 Query: 46 QTIKSEYKKFTR 11 Q +K EYK+F + Sbjct: 74 QALKHEYKEFNK 85