BLASTX nr result
ID: Mentha26_contig00035872
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00035872 (382 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30684.1| hypothetical protein MIMGU_mgv1a011154mg [Mimulus... 69 5e-10 >gb|EYU30684.1| hypothetical protein MIMGU_mgv1a011154mg [Mimulus guttatus] Length = 290 Score = 69.3 bits (168), Expect = 5e-10 Identities = 37/53 (69%), Positives = 43/53 (81%), Gaps = 5/53 (9%) Frame = +1 Query: 238 MKIEELDDS-----VIESKRSRNSSDSDMRLIAVRVDAKRALVGAGARILFYP 381 MKIEELDDS V ES+R +S+D + R++AVRVDAKRALVGAGARILFYP Sbjct: 1 MKIEELDDSSAAESVYESRRCVDSADKERRMVAVRVDAKRALVGAGARILFYP 53