BLASTX nr result
ID: Mentha26_contig00035628
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00035628 (763 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19519.1| hypothetical protein MIMGU_mgv1a009583mg [Mimulus... 60 8e-07 gb|EYU25059.1| hypothetical protein MIMGU_mgv1a010635mg [Mimulus... 59 2e-06 >gb|EYU19519.1| hypothetical protein MIMGU_mgv1a009583mg [Mimulus guttatus] Length = 337 Score = 60.1 bits (144), Expect = 8e-07 Identities = 29/41 (70%), Positives = 31/41 (75%), Gaps = 3/41 (7%) Frame = +3 Query: 648 MMRMRTKNDALPPDFNAA---GGGALDKEWELRPGGMLVQK 761 MM MRTKND LPP+ N GG A +KEWELRPGGMLVQK Sbjct: 1 MMPMRTKNDVLPPESNGGRGGGGAAAEKEWELRPGGMLVQK 41 >gb|EYU25059.1| hypothetical protein MIMGU_mgv1a010635mg [Mimulus guttatus] Length = 306 Score = 58.9 bits (141), Expect = 2e-06 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 4/42 (9%) Frame = +3 Query: 648 MMRMRTKNDALPPDFNAAG----GGALDKEWELRPGGMLVQK 761 MMRM+T+ND LPP + G GG ++KEWELRPGGMLVQK Sbjct: 1 MMRMKTRNDPLPPHIDGGGVGRRGGGVEKEWELRPGGMLVQK 42