BLASTX nr result
ID: Mentha26_contig00035528
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00035528 (328 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002308966.2| hypothetical protein POPTR_0006s05340g [Popu... 62 8e-08 ref|XP_003625495.1| K(+)/H(+) antiporter [Medicago truncatula] g... 61 2e-07 ref|XP_004494000.1| PREDICTED: cation/H(+) antiporter 20-like [C... 60 3e-07 emb|CBI30584.3| unnamed protein product [Vitis vinifera] 60 4e-07 ref|XP_002269591.1| PREDICTED: cation/H(+) antiporter 20-like [V... 60 4e-07 emb|CAN63422.1| hypothetical protein VITISV_023524 [Vitis vinifera] 60 4e-07 ref|XP_002527747.1| monovalent cation:proton antiporter, putativ... 58 1e-06 ref|XP_006429042.1| hypothetical protein CICLE_v10011092mg [Citr... 57 3e-06 ref|XP_003542459.1| PREDICTED: cation/H(+) antiporter 20-like [G... 57 3e-06 ref|XP_006480781.1| PREDICTED: cation/H(+) antiporter 20-like [C... 56 5e-06 ref|XP_006429040.1| hypothetical protein CICLE_v10011060mg [Citr... 56 5e-06 >ref|XP_002308966.2| hypothetical protein POPTR_0006s05340g [Populus trichocarpa] gi|550335516|gb|EEE92489.2| hypothetical protein POPTR_0006s05340g [Populus trichocarpa] Length = 841 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/68 (45%), Positives = 44/68 (64%) Frame = -3 Query: 254 EERDETILAEFKQKWGRTVRLVQKGISNIGKEVLAIAQSAEYDLIVVGKGQFGRRAVLGE 75 ++ DET +AEFK KW TV + +S+I + VLAI +S +YDLI VGKG+F ++ E Sbjct: 712 KDLDETAIAEFKSKWEGTVEYTENVVSDIVERVLAIGRSGDYDLIFVGKGRF-PSTMIAE 770 Query: 74 AGYEQVEY 51 Y Q E+ Sbjct: 771 LAYRQAEH 778 >ref|XP_003625495.1| K(+)/H(+) antiporter [Medicago truncatula] gi|87240332|gb|ABD32190.1| Sodium/hydrogen exchanger [Medicago truncatula] gi|355500510|gb|AES81713.1| K(+)/H(+) antiporter [Medicago truncatula] Length = 851 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/49 (53%), Positives = 38/49 (77%) Frame = -3 Query: 245 DETILAEFKQKWGRTVRLVQKGISNIGKEVLAIAQSAEYDLIVVGKGQF 99 DE + EF+ K G TV+ ++KG N+ +EV+A+ +SA+YDLIVVGKG+F Sbjct: 724 DENAMEEFRSKCGETVKYIEKGSGNVVEEVIALGESADYDLIVVGKGRF 772 >ref|XP_004494000.1| PREDICTED: cation/H(+) antiporter 20-like [Cicer arietinum] Length = 789 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/52 (48%), Positives = 39/52 (75%) Frame = -3 Query: 254 EERDETILAEFKQKWGRTVRLVQKGISNIGKEVLAIAQSAEYDLIVVGKGQF 99 +E DE + EF+ K G TV+ ++KG SN+ +EV+ I ++ +YDLI+VGKG+F Sbjct: 657 QELDEKAMEEFRSKCGETVKYIEKGSSNVVEEVIVIGENGDYDLIIVGKGRF 708 >emb|CBI30584.3| unnamed protein product [Vitis vinifera] Length = 858 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/68 (45%), Positives = 43/68 (63%) Frame = -3 Query: 254 EERDETILAEFKQKWGRTVRLVQKGISNIGKEVLAIAQSAEYDLIVVGKGQFGRRAVLGE 75 +E DE AEFK +WG V V+K SN+ + VLAI +S +YDL+VVGKG+F ++ E Sbjct: 727 KELDEIATAEFKSRWGGLVEYVEKVASNVVEGVLAIGKSGDYDLVVVGKGRF-PSTMVAE 785 Query: 74 AGYEQVEY 51 Q E+ Sbjct: 786 LAERQAEH 793 >ref|XP_002269591.1| PREDICTED: cation/H(+) antiporter 20-like [Vitis vinifera] Length = 839 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/68 (45%), Positives = 43/68 (63%) Frame = -3 Query: 254 EERDETILAEFKQKWGRTVRLVQKGISNIGKEVLAIAQSAEYDLIVVGKGQFGRRAVLGE 75 +E DE AEFK +WG V V+K SN+ + VLAI +S +YDL+VVGKG+F ++ E Sbjct: 708 KELDEIATAEFKSRWGGLVEYVEKVASNVVEGVLAIGKSGDYDLVVVGKGRF-PSTMVAE 766 Query: 74 AGYEQVEY 51 Q E+ Sbjct: 767 LAERQAEH 774 >emb|CAN63422.1| hypothetical protein VITISV_023524 [Vitis vinifera] Length = 859 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/68 (45%), Positives = 43/68 (63%) Frame = -3 Query: 254 EERDETILAEFKQKWGRTVRLVQKGISNIGKEVLAIAQSAEYDLIVVGKGQFGRRAVLGE 75 +E DE AEFK +WG V V+K SN+ + VLAI +S +YDL+VVGKG+F ++ E Sbjct: 728 KELDEIATAEFKSRWGGLVEYVEKVASNVVEGVLAIGKSGDYDLVVVGKGRF-PSTMVAE 786 Query: 74 AGYEQVEY 51 Q E+ Sbjct: 787 LAERQAEH 794 >ref|XP_002527747.1| monovalent cation:proton antiporter, putative [Ricinus communis] gi|223532888|gb|EEF34660.1| monovalent cation:proton antiporter, putative [Ricinus communis] Length = 847 Score = 58.2 bits (139), Expect = 1e-06 Identities = 31/64 (48%), Positives = 41/64 (64%) Frame = -3 Query: 290 PESENRGEVFASEERDETILAEFKQKWGRTVRLVQKGISNIGKEVLAIAQSAEYDLIVVG 111 PE E E+ D+T L EF+ KWG V ++K SNI + VLAI +S ++DLIVVG Sbjct: 712 PEKEKASEL------DDTALTEFRSKWGGMVDYIEKVDSNIVEGVLAIGRSGDHDLIVVG 765 Query: 110 KGQF 99 KG+F Sbjct: 766 KGRF 769 >ref|XP_006429042.1| hypothetical protein CICLE_v10011092mg [Citrus clementina] gi|568854328|ref|XP_006480782.1| PREDICTED: cation/H(+) antiporter 20-like [Citrus sinensis] gi|557531099|gb|ESR42282.1| hypothetical protein CICLE_v10011092mg [Citrus clementina] Length = 811 Score = 57.0 bits (136), Expect = 3e-06 Identities = 33/90 (36%), Positives = 53/90 (58%), Gaps = 14/90 (15%) Frame = -3 Query: 326 RITVIKFGGQA----------QPESE---NRGEVFASE-ERDETILAEFKQKWGRTVRLV 189 ++T+++F GQA +P S+ G F+ E E DE + +F +KWG +V Sbjct: 670 KVTLVRFIGQASRAATSSIAERPTSDISTENGNSFSRERELDEAAVDDFMRKWGGSVEYE 729 Query: 188 QKGISNIGKEVLAIAQSAEYDLIVVGKGQF 99 +K ++N+ EVL I Q +Y+L+VVGKG+F Sbjct: 730 EKVMANVKDEVLKIGQIRDYELVVVGKGRF 759 >ref|XP_003542459.1| PREDICTED: cation/H(+) antiporter 20-like [Glycine max] Length = 824 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/52 (50%), Positives = 37/52 (71%) Frame = -3 Query: 254 EERDETILAEFKQKWGRTVRLVQKGISNIGKEVLAIAQSAEYDLIVVGKGQF 99 +E D+ +A F++KW V +K SNI +EVLA+ +S +YDLI+VGKGQF Sbjct: 715 KELDDATMARFQRKWNGMVECFEKVASNIMEEVLALGRSKDYDLIIVGKGQF 766 >ref|XP_006480781.1| PREDICTED: cation/H(+) antiporter 20-like [Citrus sinensis] Length = 842 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/57 (45%), Positives = 38/57 (66%) Frame = -3 Query: 254 EERDETILAEFKQKWGRTVRLVQKGISNIGKEVLAIAQSAEYDLIVVGKGQFGRRAV 84 +E DETILAEF+ KW +K S+I + VL + +S +YDLI+VGKG+F + + Sbjct: 713 KELDETILAEFRSKWNGVADYTEKVTSSIVEGVLTLGRSGDYDLIIVGKGRFPSKMI 769 >ref|XP_006429040.1| hypothetical protein CICLE_v10011060mg [Citrus clementina] gi|557531097|gb|ESR42280.1| hypothetical protein CICLE_v10011060mg [Citrus clementina] Length = 842 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/57 (45%), Positives = 38/57 (66%) Frame = -3 Query: 254 EERDETILAEFKQKWGRTVRLVQKGISNIGKEVLAIAQSAEYDLIVVGKGQFGRRAV 84 +E DETILAEF+ KW +K S+I + VL + +S +YDLI+VGKG+F + + Sbjct: 713 KELDETILAEFRSKWNGVADYTEKVTSSIVEGVLTLGRSGDYDLIIVGKGRFPSKMI 769