BLASTX nr result
ID: Mentha26_contig00034971
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00034971 (317 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007046876.1| Uncharacterized protein TCM_000342 [Theobrom... 57 2e-06 >ref|XP_007046876.1| Uncharacterized protein TCM_000342 [Theobroma cacao] gi|508699137|gb|EOX91033.1| Uncharacterized protein TCM_000342 [Theobroma cacao] Length = 475 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/44 (56%), Positives = 34/44 (77%) Frame = -3 Query: 288 WIWGSISVALTLGSGVLAYSYLRSGKGSSSQTPSQASEADHGSK 157 W+WGSI+ A+TLG+ LA+SYL +GKGSSS + SQA + D +K Sbjct: 432 WVWGSIAAAITLGTAALAWSYLPTGKGSSSTSSSQAPDHDDAAK 475