BLASTX nr result
ID: Mentha26_contig00034788
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00034788 (352 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36304.1| hypothetical protein MIMGU_mgv1a013445mg [Mimulus... 64 2e-08 >gb|EYU36304.1| hypothetical protein MIMGU_mgv1a013445mg [Mimulus guttatus] Length = 220 Score = 63.9 bits (154), Expect = 2e-08 Identities = 37/64 (57%), Positives = 40/64 (62%), Gaps = 2/64 (3%) Frame = +1 Query: 163 IYSFHRNPISLNLISFSFSVSFPLHNTRLRAVKVRSNGGGAV--ESSQERGADLLRKPVA 336 I SFHR PIS NLI FS+SFP H L AVK S+ GGA S ADLLRKP+A Sbjct: 12 IRSFHRKPISKNLILSPFSLSFPFHKAPLCAVKTGSDDGGAAARNSQTPYAADLLRKPLA 71 Query: 337 PSPA 348 SPA Sbjct: 72 SSPA 75