BLASTX nr result
ID: Mentha26_contig00034740
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00034740 (436 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37683.1| hypothetical protein MIMGU_mgv1a002828mg [Mimulus... 71 1e-10 gb|EPS72112.1| hypothetical protein M569_02645, partial [Genlise... 71 1e-10 ref|XP_006652101.1| PREDICTED: pentatricopeptide repeat-containi... 69 7e-10 ref|XP_006487099.1| PREDICTED: pentatricopeptide repeat-containi... 69 7e-10 ref|XP_006346424.1| PREDICTED: pentatricopeptide repeat-containi... 69 7e-10 ref|XP_006345330.1| PREDICTED: pentatricopeptide repeat-containi... 69 7e-10 ref|XP_007156519.1| hypothetical protein PHAVU_003G292800g [Phas... 69 7e-10 ref|XP_006423031.1| hypothetical protein CICLE_v10028026mg [Citr... 69 7e-10 ref|XP_004961032.1| PREDICTED: pentatricopeptide repeat-containi... 69 7e-10 ref|XP_004505212.1| PREDICTED: pentatricopeptide repeat-containi... 69 7e-10 ref|XP_004505209.1| PREDICTED: pentatricopeptide repeat-containi... 69 7e-10 ref|XP_004242943.1| PREDICTED: pentatricopeptide repeat-containi... 69 7e-10 ref|XP_004230786.1| PREDICTED: pentatricopeptide repeat-containi... 69 7e-10 ref|XP_004166669.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 69 7e-10 ref|XP_004137115.1| PREDICTED: pentatricopeptide repeat-containi... 69 7e-10 gb|AFK43832.1| unknown [Lotus japonicus] 69 7e-10 gb|AFK42502.1| unknown [Medicago truncatula] 69 7e-10 ref|XP_003529393.1| PREDICTED: pentatricopeptide repeat-containi... 69 7e-10 ref|XP_003518842.1| PREDICTED: pentatricopeptide repeat-containi... 69 7e-10 ref|NP_001052155.2| Os04g0174800 [Oryza sativa Japonica Group] g... 69 7e-10 >gb|EYU37683.1| hypothetical protein MIMGU_mgv1a002828mg [Mimulus guttatus] Length = 633 Score = 71.2 bits (173), Expect = 1e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +2 Query: 2 SRVVGRELIVRDNKRFHHFKDGKCSCNDYW 91 SR+VGRELIVRDNKRFHHFKDGKCSCNDYW Sbjct: 604 SRIVGRELIVRDNKRFHHFKDGKCSCNDYW 633 >gb|EPS72112.1| hypothetical protein M569_02645, partial [Genlisea aurea] Length = 419 Score = 71.2 bits (173), Expect = 1e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +2 Query: 2 SRVVGRELIVRDNKRFHHFKDGKCSCNDYW 91 SR+VGRELIVRDNKRFHHFKDGKCSCNDYW Sbjct: 390 SRIVGRELIVRDNKRFHHFKDGKCSCNDYW 419 >ref|XP_006652101.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Oryza brachyantha] Length = 299 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 2 SRVVGRELIVRDNKRFHHFKDGKCSCNDYW 91 SR+VGRELIVRDNKRFHHFKDGKCSC DYW Sbjct: 270 SRIVGRELIVRDNKRFHHFKDGKCSCGDYW 299 >ref|XP_006487099.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Citrus sinensis] Length = 664 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 2 SRVVGRELIVRDNKRFHHFKDGKCSCNDYW 91 SR+VGRELIVRDNKRFHHFKDGKCSC DYW Sbjct: 635 SRIVGRELIVRDNKRFHHFKDGKCSCGDYW 664 >ref|XP_006346424.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like isoform X1 [Solanum tuberosum] gi|565359241|ref|XP_006346425.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like isoform X2 [Solanum tuberosum] gi|565359243|ref|XP_006346426.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like isoform X3 [Solanum tuberosum] gi|565359245|ref|XP_006346427.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like isoform X4 [Solanum tuberosum] Length = 636 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 2 SRVVGRELIVRDNKRFHHFKDGKCSCNDYW 91 SR+VGRELIVRDNKRFHHFKDGKCSC DYW Sbjct: 607 SRIVGRELIVRDNKRFHHFKDGKCSCGDYW 636 >ref|XP_006345330.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Solanum tuberosum] Length = 466 Score = 68.9 bits (167), Expect = 7e-10 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +2 Query: 2 SRVVGRELIVRDNKRFHHFKDGKCSCNDYW 91 S++VGRELIVRDNKRFHHF+DGKCSCNDYW Sbjct: 437 SKIVGRELIVRDNKRFHHFRDGKCSCNDYW 466 >ref|XP_007156519.1| hypothetical protein PHAVU_003G292800g [Phaseolus vulgaris] gi|561029873|gb|ESW28513.1| hypothetical protein PHAVU_003G292800g [Phaseolus vulgaris] Length = 571 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 2 SRVVGRELIVRDNKRFHHFKDGKCSCNDYW 91 SR+VGRELIVRDNKRFHHFKDGKCSC DYW Sbjct: 542 SRIVGRELIVRDNKRFHHFKDGKCSCGDYW 571 >ref|XP_006423031.1| hypothetical protein CICLE_v10028026mg [Citrus clementina] gi|557524965|gb|ESR36271.1| hypothetical protein CICLE_v10028026mg [Citrus clementina] Length = 623 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 2 SRVVGRELIVRDNKRFHHFKDGKCSCNDYW 91 SR+VGRELIVRDNKRFHHFKDGKCSC DYW Sbjct: 594 SRIVGRELIVRDNKRFHHFKDGKCSCGDYW 623 >ref|XP_004961032.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Setaria italica] Length = 600 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 2 SRVVGRELIVRDNKRFHHFKDGKCSCNDYW 91 SR+VGRELIVRDNKRFHHFKDGKCSC DYW Sbjct: 571 SRIVGRELIVRDNKRFHHFKDGKCSCGDYW 600 >ref|XP_004505212.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Cicer arietinum] Length = 567 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 2 SRVVGRELIVRDNKRFHHFKDGKCSCNDYW 91 SR+VGRELIVRDNKRFHHFKDGKCSC DYW Sbjct: 538 SRIVGRELIVRDNKRFHHFKDGKCSCGDYW 567 >ref|XP_004505209.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Cicer arietinum] Length = 567 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 2 SRVVGRELIVRDNKRFHHFKDGKCSCNDYW 91 SR+VGRELIVRDNKRFHHFKDGKCSC DYW Sbjct: 538 SRIVGRELIVRDNKRFHHFKDGKCSCGDYW 567 >ref|XP_004242943.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Solanum lycopersicum] Length = 466 Score = 68.9 bits (167), Expect = 7e-10 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +2 Query: 2 SRVVGRELIVRDNKRFHHFKDGKCSCNDYW 91 S++VGRELIVRDNKRFHHF+DGKCSCNDYW Sbjct: 437 SKIVGRELIVRDNKRFHHFRDGKCSCNDYW 466 >ref|XP_004230786.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Solanum lycopersicum] Length = 636 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 2 SRVVGRELIVRDNKRFHHFKDGKCSCNDYW 91 SR+VGRELIVRDNKRFHHFKDGKCSC DYW Sbjct: 607 SRIVGRELIVRDNKRFHHFKDGKCSCGDYW 636 >ref|XP_004166669.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g15690-like [Cucumis sativus] Length = 588 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 2 SRVVGRELIVRDNKRFHHFKDGKCSCNDYW 91 SR+VGRELIVRDNKRFHHFKDGKCSC DYW Sbjct: 559 SRIVGRELIVRDNKRFHHFKDGKCSCGDYW 588 >ref|XP_004137115.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Cucumis sativus] Length = 688 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 2 SRVVGRELIVRDNKRFHHFKDGKCSCNDYW 91 SR+VGRELIVRDNKRFHHFKDGKCSC DYW Sbjct: 659 SRIVGRELIVRDNKRFHHFKDGKCSCGDYW 688 >gb|AFK43832.1| unknown [Lotus japonicus] Length = 295 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 2 SRVVGRELIVRDNKRFHHFKDGKCSCNDYW 91 SR+VGRELIVRDNKRFHHFKDGKCSC DYW Sbjct: 266 SRIVGRELIVRDNKRFHHFKDGKCSCGDYW 295 >gb|AFK42502.1| unknown [Medicago truncatula] Length = 565 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 2 SRVVGRELIVRDNKRFHHFKDGKCSCNDYW 91 SR+VGRELIVRDNKRFHHFKDGKCSC DYW Sbjct: 536 SRIVGRELIVRDNKRFHHFKDGKCSCGDYW 565 >ref|XP_003529393.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Glycine max] Length = 588 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 2 SRVVGRELIVRDNKRFHHFKDGKCSCNDYW 91 SR+VGRELIVRDNKRFHHFKDGKCSC DYW Sbjct: 559 SRIVGRELIVRDNKRFHHFKDGKCSCGDYW 588 >ref|XP_003518842.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Glycine max] Length = 591 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 2 SRVVGRELIVRDNKRFHHFKDGKCSCNDYW 91 SR+VGRELIVRDNKRFHHFKDGKCSC DYW Sbjct: 562 SRIVGRELIVRDNKRFHHFKDGKCSCGDYW 591 >ref|NP_001052155.2| Os04g0174800 [Oryza sativa Japonica Group] gi|255675179|dbj|BAF14069.2| Os04g0174800 [Oryza sativa Japonica Group] Length = 299 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 2 SRVVGRELIVRDNKRFHHFKDGKCSCNDYW 91 SR+VGRELIVRDNKRFHHFKDGKCSC DYW Sbjct: 270 SRIVGRELIVRDNKRFHHFKDGKCSCGDYW 299