BLASTX nr result
ID: Mentha26_contig00034721
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00034721 (362 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27820.1| hypothetical protein MIMGU_mgv1a015656mg [Mimulus... 59 5e-07 >gb|EYU27820.1| hypothetical protein MIMGU_mgv1a015656mg [Mimulus guttatus] Length = 150 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 268 MATAMKGIYRGFKYTISQFFVVKEREIEIGY 360 M TAMKGIY+GFKYT+SQFFVVKERE+EIG+ Sbjct: 1 MGTAMKGIYKGFKYTLSQFFVVKEREMEIGF 31