BLASTX nr result
ID: Mentha26_contig00034499
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00034499 (478 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36718.1| hypothetical protein MIMGU_mgv1a004324mg [Mimulus... 57 3e-08 gb|EXB95198.1| hypothetical protein L484_001595 [Morus notabilis] 57 4e-06 ref|XP_002533839.1| conserved hypothetical protein [Ricinus comm... 57 4e-06 ref|XP_006442953.1| hypothetical protein CICLE_v10019609mg [Citr... 56 6e-06 >gb|EYU36718.1| hypothetical protein MIMGU_mgv1a004324mg [Mimulus guttatus] Length = 533 Score = 57.4 bits (137), Expect(2) = 3e-08 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +1 Query: 376 DLDHDTVRVDPLDGLKKYRGGFDITNVNYWSSTA 477 ++ DTVRVDPLD KKYRGG+DITN +YW+STA Sbjct: 45 NVSDDTVRVDPLDSFKKYRGGYDITNKHYWASTA 78 Score = 25.8 bits (55), Expect(2) = 3e-08 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +3 Query: 228 MAKLLLIITIIMALSLPILSTNSKS 302 + ++L + +I SLPILST S+S Sbjct: 11 LTAIILALNLIQITSLPILSTTSQS 35 >gb|EXB95198.1| hypothetical protein L484_001595 [Morus notabilis] Length = 533 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +1 Query: 388 DTVRVDPLDGLKKYRGGFDITNVNYWSST 474 DTVRVDPLD KKYRGG+DITN +YWSST Sbjct: 61 DTVRVDPLDNFKKYRGGYDITNKHYWSST 89 >ref|XP_002533839.1| conserved hypothetical protein [Ricinus communis] gi|223526218|gb|EEF28541.1| conserved hypothetical protein [Ricinus communis] Length = 523 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +1 Query: 388 DTVRVDPLDGLKKYRGGFDITNVNYWSST 474 DTVRVDPLD KKYRGG+DITN +YWSST Sbjct: 52 DTVRVDPLDNFKKYRGGYDITNKHYWSST 80 >ref|XP_006442953.1| hypothetical protein CICLE_v10019609mg [Citrus clementina] gi|568850082|ref|XP_006478757.1| PREDICTED: uncharacterized protein LOC102612170 isoform X1 [Citrus sinensis] gi|568850084|ref|XP_006478758.1| PREDICTED: uncharacterized protein LOC102612170 isoform X2 [Citrus sinensis] gi|557545215|gb|ESR56193.1| hypothetical protein CICLE_v10019609mg [Citrus clementina] Length = 542 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +1 Query: 382 DHDTVRVDPLDGLKKYRGGFDITNVNYWSST 474 D DTVR DPL+ LKKYRGG+DITN +YWSST Sbjct: 56 DDDTVRADPLNKLKKYRGGYDITNKHYWSST 86