BLASTX nr result
ID: Mentha26_contig00034456
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00034456 (498 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43479.1| hypothetical protein MIMGU_mgv1a011894mg [Mimulus... 63 5e-08 gb|AFK43713.1| unknown [Lotus japonicus] 59 9e-07 ref|XP_001765309.1| predicted protein [Physcomitrella patens] gi... 59 9e-07 ref|XP_006351023.1| PREDICTED: probable plastid-lipid-associated... 58 1e-06 gb|EXB76037.1| putative plastid-lipid-associated protein 7 [Moru... 58 2e-06 ref|XP_004503974.1| PREDICTED: probable plastid-lipid-associated... 57 2e-06 ref|XP_004306596.1| PREDICTED: probable plastid-lipid-associated... 57 2e-06 ref|XP_006653391.1| PREDICTED: probable plastid-lipid-associated... 57 3e-06 ref|XP_004249867.1| PREDICTED: probable plastid-lipid-associated... 57 3e-06 ref|XP_003630181.1| Fibrillin [Medicago truncatula] gi|355524203... 57 3e-06 emb|CBI37604.3| unnamed protein product [Vitis vinifera] 57 3e-06 ref|XP_002276832.1| PREDICTED: probable plastid-lipid-associated... 57 3e-06 ref|XP_007159807.1| hypothetical protein PHAVU_002G269000g [Phas... 56 4e-06 ref|XP_006427886.1| hypothetical protein CICLE_v10026263mg [Citr... 56 4e-06 ref|XP_006580324.1| PREDICTED: probable plastid-lipid-associated... 56 6e-06 ref|XP_002300202.2| hypothetical protein POPTR_0001s31680g [Popu... 56 6e-06 ref|XP_007048240.1| Plastid-lipid associated protein PAP / fibri... 56 6e-06 ref|XP_003525106.1| PREDICTED: probable plastid-lipid-associated... 56 6e-06 ref|XP_002522199.1| structural molecule, putative [Ricinus commu... 56 6e-06 gb|ABR26046.1| plastid-lipid associated protein pap [Oryza sativ... 55 8e-06 >gb|EYU43479.1| hypothetical protein MIMGU_mgv1a011894mg [Mimulus guttatus] Length = 267 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 496 GWLEITYVDDSLRIGRDDKGNIFILERVISE 404 GWLEITYVDDSLRIGRDDKGNIFILER++ E Sbjct: 233 GWLEITYVDDSLRIGRDDKGNIFILERLLEE 263 >gb|AFK43713.1| unknown [Lotus japonicus] Length = 258 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -3 Query: 496 GWLEITYVDDSLRIGRDDKGNIFILER 416 GWLEITYVDDS+RIGRDDKGNIF+LER Sbjct: 225 GWLEITYVDDSMRIGRDDKGNIFVLER 251 >ref|XP_001765309.1| predicted protein [Physcomitrella patens] gi|162683628|gb|EDQ70037.1| predicted protein [Physcomitrella patens] Length = 178 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = -3 Query: 496 GWLEITYVDDSLRIGRDDKGNIFILERV 413 GWLEITY+DDSLRIGRDDKGN+F+LER+ Sbjct: 151 GWLEITYIDDSLRIGRDDKGNVFLLERM 178 >ref|XP_006351023.1| PREDICTED: probable plastid-lipid-associated protein 7, chloroplastic-like isoform X1 [Solanum tuberosum] Length = 258 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = -3 Query: 496 GWLEITYVDDSLRIGRDDKGNIFILERV 413 GWLEITYVD++LRIGRDDKGNIF+LERV Sbjct: 230 GWLEITYVDENLRIGRDDKGNIFVLERV 257 >gb|EXB76037.1| putative plastid-lipid-associated protein 7 [Morus notabilis] Length = 230 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -3 Query: 496 GWLEITYVDDSLRIGRDDKGNIFILER 416 GWLEITYVDD++RIGRDDKGNIFILER Sbjct: 195 GWLEITYVDDTMRIGRDDKGNIFILER 221 >ref|XP_004503974.1| PREDICTED: probable plastid-lipid-associated protein 7, chloroplastic-like [Cicer arietinum] Length = 240 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = -3 Query: 496 GWLEITYVDDSLRIGRDDKGNIFILER 416 GWLEITYVDD++RIGRDDKGNIF+LER Sbjct: 208 GWLEITYVDDTMRIGRDDKGNIFVLER 234 >ref|XP_004306596.1| PREDICTED: probable plastid-lipid-associated protein 7, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 264 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -3 Query: 496 GWLEITYVDDSLRIGRDDKGNIFILER 416 GWLEITYVDD++RIGRDDKGNIFILER Sbjct: 232 GWLEITYVDDTVRIGRDDKGNIFILER 258 >ref|XP_006653391.1| PREDICTED: probable plastid-lipid-associated protein 7, chloroplastic-like [Oryza brachyantha] Length = 237 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 496 GWLEITYVDDSLRIGRDDKGNIFILER 416 GWLEITYVDDSLRIGRDDK NIF+LER Sbjct: 205 GWLEITYVDDSLRIGRDDKANIFVLER 231 >ref|XP_004249867.1| PREDICTED: probable plastid-lipid-associated protein 7, chloroplastic-like [Solanum lycopersicum] Length = 256 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = -3 Query: 496 GWLEITYVDDSLRIGRDDKGNIFILERV 413 GWLEITYVD++LRIG+DDKGNIF+LERV Sbjct: 228 GWLEITYVDENLRIGKDDKGNIFVLERV 255 >ref|XP_003630181.1| Fibrillin [Medicago truncatula] gi|355524203|gb|AET04657.1| Fibrillin [Medicago truncatula] Length = 273 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -3 Query: 496 GWLEITYVDDSLRIGRDDKGNIFILER 416 GWLEITYVDD +RIGRDDKGNIF+LER Sbjct: 240 GWLEITYVDDKMRIGRDDKGNIFVLER 266 >emb|CBI37604.3| unnamed protein product [Vitis vinifera] Length = 260 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = -3 Query: 496 GWLEITYVDDSLRIGRDDKGNIFILER 416 GWLEITY+DDS+RIGRDDKGN+FILER Sbjct: 230 GWLEITYLDDSMRIGRDDKGNLFILER 256 >ref|XP_002276832.1| PREDICTED: probable plastid-lipid-associated protein 7, chloroplastic [Vitis vinifera] Length = 285 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = -3 Query: 496 GWLEITYVDDSLRIGRDDKGNIFILER 416 GWLEITY+DDS+RIGRDDKGN+FILER Sbjct: 255 GWLEITYLDDSMRIGRDDKGNLFILER 281 >ref|XP_007159807.1| hypothetical protein PHAVU_002G269000g [Phaseolus vulgaris] gi|561033222|gb|ESW31801.1| hypothetical protein PHAVU_002G269000g [Phaseolus vulgaris] Length = 268 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -3 Query: 496 GWLEITYVDDSLRIGRDDKGNIFILER 416 GWLEITYVDDS+RIGRDDK NIF+LER Sbjct: 235 GWLEITYVDDSMRIGRDDKSNIFVLER 261 >ref|XP_006427886.1| hypothetical protein CICLE_v10026263mg [Citrus clementina] gi|568820048|ref|XP_006464543.1| PREDICTED: probable plastid-lipid-associated protein 7, chloroplastic-like [Citrus sinensis] gi|557529876|gb|ESR41126.1| hypothetical protein CICLE_v10026263mg [Citrus clementina] Length = 272 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = -3 Query: 496 GWLEITYVDDSLRIGRDDKGNIFILER 416 GWLEI+YVDD++RIGRDDKGNIFILER Sbjct: 236 GWLEISYVDDTMRIGRDDKGNIFILER 262 >ref|XP_006580324.1| PREDICTED: probable plastid-lipid-associated protein 7, chloroplastic-like isoform X3 [Glycine max] Length = 235 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -3 Query: 496 GWLEITYVDDSLRIGRDDKGNIFILER 416 GWLEITYVDD+LRIGRDDK NIF+LER Sbjct: 202 GWLEITYVDDTLRIGRDDKSNIFVLER 228 >ref|XP_002300202.2| hypothetical protein POPTR_0001s31680g [Populus trichocarpa] gi|550348653|gb|EEE85007.2| hypothetical protein POPTR_0001s31680g [Populus trichocarpa] Length = 278 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -3 Query: 496 GWLEITYVDDSLRIGRDDKGNIFILER 416 GWLEITYVDD++RIGRDD GNIFILER Sbjct: 246 GWLEITYVDDNMRIGRDDSGNIFILER 272 >ref|XP_007048240.1| Plastid-lipid associated protein PAP / fibrillin family protein isoform 1 [Theobroma cacao] gi|508700501|gb|EOX92397.1| Plastid-lipid associated protein PAP / fibrillin family protein isoform 1 [Theobroma cacao] Length = 306 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -3 Query: 496 GWLEITYVDDSLRIGRDDKGNIFILER 416 GWLEITYVDD++RIGRDDKGN FILER Sbjct: 271 GWLEITYVDDTMRIGRDDKGNTFILER 297 >ref|XP_003525106.1| PREDICTED: probable plastid-lipid-associated protein 7, chloroplastic-like isoform X1 [Glycine max] Length = 268 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -3 Query: 496 GWLEITYVDDSLRIGRDDKGNIFILER 416 GWLEITYVDD+LRIGRDDK NIF+LER Sbjct: 235 GWLEITYVDDTLRIGRDDKSNIFVLER 261 >ref|XP_002522199.1| structural molecule, putative [Ricinus communis] gi|223538570|gb|EEF40174.1| structural molecule, putative [Ricinus communis] Length = 266 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -3 Query: 496 GWLEITYVDDSLRIGRDDKGNIFILERVI 410 GWL+ITYVDD+ RIGRDDKGNIFILER + Sbjct: 238 GWLDITYVDDNTRIGRDDKGNIFILERSV 266 >gb|ABR26046.1| plastid-lipid associated protein pap [Oryza sativa Indica Group] Length = 168 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -3 Query: 496 GWLEITYVDDSLRIGRDDKGNIFILER 416 GWLEITYVD+SLRIGRDDK NIF+LER Sbjct: 136 GWLEITYVDESLRIGRDDKANIFVLER 162