BLASTX nr result
ID: Mentha26_contig00034302
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00034302 (306 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41502.1| hypothetical protein MIMGU_mgv1a000165mg [Mimulus... 68 1e-09 gb|EPS62170.1| hypothetical protein M569_12620, partial [Genlise... 63 5e-08 gb|EPS66746.1| hypothetical protein M569_08030, partial [Genlise... 59 5e-07 ref|XP_002277982.2| PREDICTED: protein TIME FOR COFFEE-like [Vit... 57 3e-06 emb|CBI26227.3| unnamed protein product [Vitis vinifera] 57 3e-06 >gb|EYU41502.1| hypothetical protein MIMGU_mgv1a000165mg [Mimulus guttatus] Length = 1514 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -3 Query: 124 LQHRKSFPPASSTAAKISRAPPVWKSGDEMISAPVPRKARS 2 LQHRKSFP SS++AK+ RAPPVWKSGDEMISA VPRKARS Sbjct: 179 LQHRKSFP-LSSSSAKVLRAPPVWKSGDEMISASVPRKARS 218 >gb|EPS62170.1| hypothetical protein M569_12620, partial [Genlisea aurea] Length = 298 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -3 Query: 121 QHRKSFPPASSTAAKISRAPPVWKSGDEMISAPVPRKARS 2 Q+RK+FPP SS++ K+ R+PPVWKSGDEMI+ P+PRKARS Sbjct: 4 QNRKAFPPGSSSS-KLFRSPPVWKSGDEMITVPIPRKARS 42 >gb|EPS66746.1| hypothetical protein M569_08030, partial [Genlisea aurea] Length = 525 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -3 Query: 124 LQHRKSFPPASSTAAKISRAPPVWKSGDEMISAPVPRKARS 2 + HRK +PP SS++ K+ R+PPVWKSGDEMI VPRKARS Sbjct: 157 IHHRKPYPPGSSSS-KVFRSPPVWKSGDEMIGISVPRKARS 196 >ref|XP_002277982.2| PREDICTED: protein TIME FOR COFFEE-like [Vitis vinifera] Length = 1587 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/40 (67%), Positives = 30/40 (75%) Frame = -3 Query: 121 QHRKSFPPASSTAAKISRAPPVWKSGDEMISAPVPRKARS 2 QHRKS+PPA K+ RAPPVWK+ DEMI VPRKARS Sbjct: 127 QHRKSYPPA-----KVVRAPPVWKAADEMIGVSVPRKARS 161 >emb|CBI26227.3| unnamed protein product [Vitis vinifera] Length = 966 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/40 (67%), Positives = 30/40 (75%) Frame = -3 Query: 121 QHRKSFPPASSTAAKISRAPPVWKSGDEMISAPVPRKARS 2 QHRKS+PPA K+ RAPPVWK+ DEMI VPRKARS Sbjct: 127 QHRKSYPPA-----KVVRAPPVWKAADEMIGVSVPRKARS 161