BLASTX nr result
ID: Mentha26_contig00034299
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00034299 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24724.1| hypothetical protein MIMGU_mgv1a015220mg [Mimulus... 55 8e-06 >gb|EYU24724.1| hypothetical protein MIMGU_mgv1a015220mg [Mimulus guttatus] Length = 164 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/39 (76%), Positives = 32/39 (82%), Gaps = 7/39 (17%) Frame = +1 Query: 37 RHQDIALDMLIKLVRVFGSVIY-------SVGLDIEAEQ 132 RHQDIALDML+KLVRVFGSVIY SVG+DIEAEQ Sbjct: 82 RHQDIALDMLLKLVRVFGSVIYSSLSAPSSVGVDIEAEQ 120