BLASTX nr result
ID: Mentha26_contig00034177
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00034177 (344 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40060.1| hypothetical protein MIMGU_mgv1a002749mg [Mimulus... 56 6e-06 >gb|EYU40060.1| hypothetical protein MIMGU_mgv1a002749mg [Mimulus guttatus] Length = 641 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/40 (70%), Positives = 33/40 (82%), Gaps = 3/40 (7%) Frame = -3 Query: 267 VYLDTGP*VPTFVTPFHKHGSNLLQAVGEFNG---IVVSS 157 +Y+DTGP +PT VTP K+GSNLLQAVGEFNG IVV+S Sbjct: 245 LYMDTGPQIPTVVTPLLKYGSNLLQAVGEFNGNYIIVVAS 284