BLASTX nr result
ID: Mentha26_contig00034134
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00034134 (315 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006382425.1| zinc finger family protein [Populus trichoca... 56 4e-06 ref|XP_006645414.1| PREDICTED: GATA transcription factor 16-like... 56 6e-06 gb|EPS59020.1| hypothetical protein M569_15793, partial [Genlise... 56 6e-06 >ref|XP_006382425.1| zinc finger family protein [Populus trichocarpa] gi|550337785|gb|ERP60222.1| zinc finger family protein [Populus trichocarpa] Length = 161 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/46 (56%), Positives = 32/46 (69%), Gaps = 2/46 (4%) Frame = +1 Query: 184 MDLKVDKKA--DFEQKNGGVSPLKSCSDCHTTRTPLWRGGPAGPKS 315 MDLK K + D +G + K+C+DC TT+TPLWRGGPAGPKS Sbjct: 1 MDLKGTKSSREDESSGSGDIEGKKACTDCKTTKTPLWRGGPAGPKS 46 >ref|XP_006645414.1| PREDICTED: GATA transcription factor 16-like [Oryza brachyantha] Length = 139 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/46 (56%), Positives = 32/46 (69%) Frame = +1 Query: 178 DRMDLKVDKKADFEQKNGGVSPLKSCSDCHTTRTPLWRGGPAGPKS 315 D + VDK D ++ NG K+C+DCHTT+TPLWRGGP GPKS Sbjct: 4 DSVSSPVDK-VDPDESNGS----KACADCHTTKTPLWRGGPGGPKS 44 >gb|EPS59020.1| hypothetical protein M569_15793, partial [Genlisea aurea] Length = 87 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +1 Query: 244 LKSCSDCHTTRTPLWRGGPAGPKS 315 LKSCSDC TTRTPLWRGGPAGPKS Sbjct: 1 LKSCSDCRTTRTPLWRGGPAGPKS 24