BLASTX nr result
ID: Mentha26_contig00034068
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00034068 (392 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS61145.1| hypothetical protein M569_13654 [Genlisea aurea] 56 6e-06 >gb|EPS61145.1| hypothetical protein M569_13654 [Genlisea aurea] Length = 565 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +1 Query: 298 MKKTKNPMVFMDVSIDGDAAERIIIELFAD 387 MKKTKNP VF+D+S+DG+AAERI+IELFAD Sbjct: 1 MKKTKNPFVFLDISVDGNAAERIVIELFAD 30