BLASTX nr result
ID: Mentha26_contig00034039
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00034039 (302 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007157838.1| hypothetical protein PHAVU_002G102500g [Phas... 62 8e-08 ref|XP_006605542.1| PREDICTED: 14-3-3-like protein GF14 iota-lik... 61 2e-07 ref|XP_003528560.2| PREDICTED: 14-3-3-like protein GF14 iota-lik... 61 2e-07 ref|XP_006484187.1| PREDICTED: 14-3-3-like protein GF14 iota-lik... 61 2e-07 ref|XP_006437949.1| hypothetical protein CICLE_v10033402mg [Citr... 61 2e-07 ref|XP_007045894.1| General regulatory factor 12, IOTA isoform 2... 61 2e-07 ref|XP_007045893.1| General regulatory factor 12, IOTA isoform 1... 61 2e-07 ref|XP_007227176.1| hypothetical protein PRUPE_ppa020788mg, part... 61 2e-07 emb|CBI27277.3| unnamed protein product [Vitis vinifera] 61 2e-07 ref|XP_002269100.1| PREDICTED: 14-3-3-like protein GF14 iota-lik... 61 2e-07 ref|XP_002512093.1| 14-3-3 protein, putative [Ricinus communis] ... 61 2e-07 ref|XP_006415927.1| hypothetical protein EUTSA_v10008445mg [Eutr... 60 2e-07 gb|AAF98570.1|AC013427_13 Strong similarity to GF14 mu from Arab... 60 2e-07 ref|NP_564249.1| 14-3-3-like protein GF14 iota [Arabidopsis thal... 60 2e-07 gb|AFK49338.1| unknown [Medicago truncatula] 60 2e-07 ref|XP_003614051.1| 14-3-3-like protein GF14 iota [Medicago trun... 60 2e-07 ref|NP_001238423.1| 14-3-3 protein SGF14e [Glycine max] gi|31693... 60 2e-07 ref|NP_001238407.1| 14-3-3 protein SGF14f [Glycine max] gi|31693... 60 2e-07 ref|XP_002890655.1| hypothetical protein ARALYDRAFT_313341 [Arab... 60 2e-07 gb|ACU22928.1| unknown [Glycine max] 60 2e-07 >ref|XP_007157838.1| hypothetical protein PHAVU_002G102500g [Phaseolus vulgaris] gi|561031253|gb|ESW29832.1| hypothetical protein PHAVU_002G102500g [Phaseolus vulgaris] Length = 258 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 189 KGDYYRYLAEFKSDEERKEAAEQSLKGYEA 100 KGDYYRYLAEFK+D+ERKEAAEQSLKGYEA Sbjct: 128 KGDYYRYLAEFKTDQERKEAAEQSLKGYEA 157 >ref|XP_006605542.1| PREDICTED: 14-3-3-like protein GF14 iota-like [Glycine max] Length = 260 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 189 KGDYYRYLAEFKSDEERKEAAEQSLKGYEA 100 KGDYYRYLAEFK+D++RKEAAEQSLKGYEA Sbjct: 128 KGDYYRYLAEFKTDQDRKEAAEQSLKGYEA 157 >ref|XP_003528560.2| PREDICTED: 14-3-3-like protein GF14 iota-like [Glycine max] Length = 259 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 189 KGDYYRYLAEFKSDEERKEAAEQSLKGYEA 100 KGDYYRYLAEFK+D++RKEAAEQSLKGYEA Sbjct: 128 KGDYYRYLAEFKTDQDRKEAAEQSLKGYEA 157 >ref|XP_006484187.1| PREDICTED: 14-3-3-like protein GF14 iota-like [Citrus sinensis] Length = 261 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 189 KGDYYRYLAEFKSDEERKEAAEQSLKGYEA 100 KGDYYRYLAEFK D+ERKEAAEQSLKGYEA Sbjct: 129 KGDYYRYLAEFKVDQERKEAAEQSLKGYEA 158 >ref|XP_006437949.1| hypothetical protein CICLE_v10033402mg [Citrus clementina] gi|557540145|gb|ESR51189.1| hypothetical protein CICLE_v10033402mg [Citrus clementina] Length = 311 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 189 KGDYYRYLAEFKSDEERKEAAEQSLKGYEA 100 KGDYYRYLAEFK D+ERKEAAEQSLKGYEA Sbjct: 129 KGDYYRYLAEFKVDQERKEAAEQSLKGYEA 158 >ref|XP_007045894.1| General regulatory factor 12, IOTA isoform 2 [Theobroma cacao] gi|508709829|gb|EOY01726.1| General regulatory factor 12, IOTA isoform 2 [Theobroma cacao] Length = 261 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 189 KGDYYRYLAEFKSDEERKEAAEQSLKGYEA 100 KGDYYRY+AEFK+D+ERKEAAEQSLKGYEA Sbjct: 129 KGDYYRYVAEFKTDQERKEAAEQSLKGYEA 158 >ref|XP_007045893.1| General regulatory factor 12, IOTA isoform 1 [Theobroma cacao] gi|508709828|gb|EOY01725.1| General regulatory factor 12, IOTA isoform 1 [Theobroma cacao] Length = 307 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 189 KGDYYRYLAEFKSDEERKEAAEQSLKGYEA 100 KGDYYRY+AEFK+D+ERKEAAEQSLKGYEA Sbjct: 129 KGDYYRYVAEFKTDQERKEAAEQSLKGYEA 158 >ref|XP_007227176.1| hypothetical protein PRUPE_ppa020788mg, partial [Prunus persica] gi|462424112|gb|EMJ28375.1| hypothetical protein PRUPE_ppa020788mg, partial [Prunus persica] Length = 262 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 189 KGDYYRYLAEFKSDEERKEAAEQSLKGYEA 100 KGDYYRYLAEFK+D++RKEAAEQSLKGYEA Sbjct: 129 KGDYYRYLAEFKTDQDRKEAAEQSLKGYEA 158 >emb|CBI27277.3| unnamed protein product [Vitis vinifera] Length = 253 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 189 KGDYYRYLAEFKSDEERKEAAEQSLKGYEA 100 KGDYYRYLAEFK+D+ERKEA+EQSLKGYEA Sbjct: 116 KGDYYRYLAEFKTDQERKEASEQSLKGYEA 145 >ref|XP_002269100.1| PREDICTED: 14-3-3-like protein GF14 iota-like [Vitis vinifera] Length = 260 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 189 KGDYYRYLAEFKSDEERKEAAEQSLKGYEA 100 KGDYYRYLAEFK+D+ERKEA+EQSLKGYEA Sbjct: 128 KGDYYRYLAEFKTDQERKEASEQSLKGYEA 157 >ref|XP_002512093.1| 14-3-3 protein, putative [Ricinus communis] gi|223549273|gb|EEF50762.1| 14-3-3 protein, putative [Ricinus communis] Length = 262 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 189 KGDYYRYLAEFKSDEERKEAAEQSLKGYEA 100 KGDYYRYLAEFK+D++RKEAAEQSLKGYEA Sbjct: 128 KGDYYRYLAEFKADQDRKEAAEQSLKGYEA 157 >ref|XP_006415927.1| hypothetical protein EUTSA_v10008445mg [Eutrema salsugineum] gi|557093698|gb|ESQ34280.1| hypothetical protein EUTSA_v10008445mg [Eutrema salsugineum] Length = 276 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 189 KGDYYRYLAEFKSDEERKEAAEQSLKGYEA 100 KGDYYRYLAEFK+++ERKEAAEQSLKGYEA Sbjct: 130 KGDYYRYLAEFKTEQERKEAAEQSLKGYEA 159 >gb|AAF98570.1|AC013427_13 Strong similarity to GF14 mu from Arabidopsis thaliana gb|AB011545 and is a member of the 14-3-3 protein PF|00244 family [Arabidopsis thaliana] Length = 286 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 189 KGDYYRYLAEFKSDEERKEAAEQSLKGYEA 100 KGDYYRYLAEFK+++ERKEAAEQSLKGYEA Sbjct: 131 KGDYYRYLAEFKTEQERKEAAEQSLKGYEA 160 >ref|NP_564249.1| 14-3-3-like protein GF14 iota [Arabidopsis thaliana] gi|20137460|sp|Q9C5W6.1|14312_ARATH RecName: Full=14-3-3-like protein GF14 iota; AltName: Full=General regulatory factor 12 gi|12963453|gb|AAK11271.1|AF335544_1 14-3-3 protein GF14iota [Arabidopsis thaliana] gi|26450876|dbj|BAC42545.1| putative 14-3-3 protein epsilon [Arabidopsis thaliana] gi|30017291|gb|AAP12879.1| At1g26480 [Arabidopsis thaliana] gi|332192575|gb|AEE30696.1| 14-3-3-like protein GF14 iota [Arabidopsis thaliana] Length = 268 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 189 KGDYYRYLAEFKSDEERKEAAEQSLKGYEA 100 KGDYYRYLAEFK+++ERKEAAEQSLKGYEA Sbjct: 131 KGDYYRYLAEFKTEQERKEAAEQSLKGYEA 160 >gb|AFK49338.1| unknown [Medicago truncatula] Length = 259 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 189 KGDYYRYLAEFKSDEERKEAAEQSLKGYEA 100 KGDY+RYLAEFK+D+ERKEAAEQSLKGYEA Sbjct: 128 KGDYFRYLAEFKTDQERKEAAEQSLKGYEA 157 >ref|XP_003614051.1| 14-3-3-like protein GF14 iota [Medicago truncatula] gi|355515386|gb|AES97009.1| 14-3-3-like protein GF14 iota [Medicago truncatula] Length = 259 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 189 KGDYYRYLAEFKSDEERKEAAEQSLKGYEA 100 KGDY+RYLAEFK+D+ERKEAAEQSLKGYEA Sbjct: 128 KGDYFRYLAEFKTDQERKEAAEQSLKGYEA 157 >ref|NP_001238423.1| 14-3-3 protein SGF14e [Glycine max] gi|316937090|gb|ADU60529.1| SGF14e [Glycine max] Length = 259 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 189 KGDYYRYLAEFKSDEERKEAAEQSLKGYEA 100 KGDY+RYLAEFK+D+ERKEAAEQSLKGYEA Sbjct: 128 KGDYFRYLAEFKTDQERKEAAEQSLKGYEA 157 >ref|NP_001238407.1| 14-3-3 protein SGF14f [Glycine max] gi|316937086|gb|ADU60527.1| SGF14f [Glycine max] Length = 259 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 189 KGDYYRYLAEFKSDEERKEAAEQSLKGYEA 100 KGDY+RYLAEFK+D+ERKEAAEQSLKGYEA Sbjct: 128 KGDYFRYLAEFKTDQERKEAAEQSLKGYEA 157 >ref|XP_002890655.1| hypothetical protein ARALYDRAFT_313341 [Arabidopsis lyrata subsp. lyrata] gi|297336497|gb|EFH66914.1| hypothetical protein ARALYDRAFT_313341 [Arabidopsis lyrata subsp. lyrata] Length = 286 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 189 KGDYYRYLAEFKSDEERKEAAEQSLKGYEA 100 KGDYYRYLAEFK+++ERKEAAEQSLKGYEA Sbjct: 131 KGDYYRYLAEFKTEQERKEAAEQSLKGYEA 160 >gb|ACU22928.1| unknown [Glycine max] Length = 259 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 189 KGDYYRYLAEFKSDEERKEAAEQSLKGYEA 100 KGDY+RYLAEFK+D+ERKEAAEQSLKGYEA Sbjct: 128 KGDYFRYLAEFKTDQERKEAAEQSLKGYEA 157