BLASTX nr result
ID: Mentha26_contig00033987
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00033987 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533124.1| polypyrimidine tract binding protein, putati... 57 3e-06 >ref|XP_002533124.1| polypyrimidine tract binding protein, putative [Ricinus communis] gi|223527087|gb|EEF29269.1| polypyrimidine tract binding protein, putative [Ricinus communis] Length = 483 Score = 57.0 bits (136), Expect = 3e-06 Identities = 33/85 (38%), Positives = 39/85 (45%), Gaps = 24/85 (28%) Frame = +3 Query: 6 SWYPS----GEAYASVPPSTFPGQAYNSAPSPAYATSANPASGPPNTRNGP--------- 146 +W PS G AY SVPP TFPGQ+Y AP P Y ++A P P T+ P Sbjct: 399 AWNPSMEAGGPAYPSVPPGTFPGQSY-PAPPPTYVSAAMPVGSSPLTQGSPMSPGVGTMP 457 Query: 147 -----------PGATSHPSQSPYYG 188 PG S P Q P+YG Sbjct: 458 MTHPGVQSNLRPGGASPPGQPPFYG 482