BLASTX nr result
ID: Mentha26_contig00033795
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00033795 (514 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39273.1| hypothetical protein MIMGU_mgv1a025401mg [Mimulus... 109 4e-22 gb|EYU25997.1| hypothetical protein MIMGU_mgv1a020660mg [Mimulus... 108 6e-22 ref|XP_007031218.1| Pentatricopeptide repeat (PPR) superfamily p... 108 6e-22 ref|XP_006356525.1| PREDICTED: pentatricopeptide repeat-containi... 106 3e-21 ref|XP_004984577.1| PREDICTED: pentatricopeptide repeat-containi... 106 4e-21 ref|NP_001173399.1| Os03g0317100 [Oryza sativa Japonica Group] g... 106 4e-21 gb|ABF95626.1| pentatricopeptide, putative [Oryza sativa Japonic... 106 4e-21 ref|XP_006651327.1| PREDICTED: pentatricopeptide repeat-containi... 105 5e-21 ref|XP_006428236.1| hypothetical protein CICLE_v10011195mg [Citr... 105 5e-21 gb|EAY89771.1| hypothetical protein OsI_11313 [Oryza sativa Indi... 105 5e-21 ref|XP_002277031.2| PREDICTED: pentatricopeptide repeat-containi... 105 6e-21 ref|XP_003558041.1| PREDICTED: pentatricopeptide repeat-containi... 105 6e-21 ref|XP_003533650.1| PREDICTED: pentatricopeptide repeat-containi... 105 6e-21 emb|CBI39641.3| unnamed protein product [Vitis vinifera] 105 6e-21 ref|XP_006301656.1| hypothetical protein CARUB_v10022106mg [Caps... 105 8e-21 ref|XP_004242257.1| PREDICTED: pentatricopeptide repeat-containi... 105 8e-21 ref|XP_004492592.1| PREDICTED: pentatricopeptide repeat-containi... 104 1e-20 ref|XP_003623648.1| Pentatricopeptide repeat-containing protein ... 104 1e-20 ref|XP_007140043.1| hypothetical protein PHAVU_008G079600g [Phas... 103 2e-20 ref|NP_176062.1| pentatricopeptide repeat-containing protein [Ar... 103 2e-20 >gb|EYU39273.1| hypothetical protein MIMGU_mgv1a025401mg [Mimulus guttatus] Length = 631 Score = 109 bits (272), Expect = 4e-22 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = -1 Query: 514 EDVPIRVMKNLRVCGDCHTAIKLISNITKREIILRDANRFHHFKDGVCSCKDYW 353 E V IRVMKNLRVCGDCHTAIKLI+N+T+REIILRDANRFHHFKDG+CSC+DYW Sbjct: 578 EGVAIRVMKNLRVCGDCHTAIKLIANVTRREIILRDANRFHHFKDGLCSCRDYW 631 >gb|EYU25997.1| hypothetical protein MIMGU_mgv1a020660mg [Mimulus guttatus] Length = 631 Score = 108 bits (271), Expect = 6e-22 Identities = 46/54 (85%), Positives = 52/54 (96%) Frame = -1 Query: 514 EDVPIRVMKNLRVCGDCHTAIKLISNITKREIILRDANRFHHFKDGVCSCKDYW 353 E V IRVMKNLRVCGDCHTA+KLI+N+T+REIILRDANRFHHFKDG+CSC+DYW Sbjct: 578 EGVAIRVMKNLRVCGDCHTAVKLIANVTRREIILRDANRFHHFKDGLCSCRDYW 631 >ref|XP_007031218.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 [Theobroma cacao] gi|590644940|ref|XP_007031219.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 [Theobroma cacao] gi|508719823|gb|EOY11720.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 [Theobroma cacao] gi|508719824|gb|EOY11721.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 [Theobroma cacao] Length = 731 Score = 108 bits (271), Expect = 6e-22 Identities = 46/54 (85%), Positives = 52/54 (96%) Frame = -1 Query: 514 EDVPIRVMKNLRVCGDCHTAIKLISNITKREIILRDANRFHHFKDGVCSCKDYW 353 +++PIRVMKNLRVCGDCHTAIKLI+ +TKREIILRDANRFHHFKDG CSC+DYW Sbjct: 678 KEMPIRVMKNLRVCGDCHTAIKLIAKVTKREIILRDANRFHHFKDGFCSCRDYW 731 >ref|XP_006356525.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Solanum tuberosum] Length = 704 Score = 106 bits (265), Expect = 3e-21 Identities = 46/54 (85%), Positives = 51/54 (94%) Frame = -1 Query: 514 EDVPIRVMKNLRVCGDCHTAIKLISNITKREIILRDANRFHHFKDGVCSCKDYW 353 E +PIRVMKNLRVCGDCH+AIKLI+ +T REIILRDANRFHHFKDGVCSCKD+W Sbjct: 651 EGMPIRVMKNLRVCGDCHSAIKLIAKVTGREIILRDANRFHHFKDGVCSCKDFW 704 >ref|XP_004984577.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Setaria italica] Length = 706 Score = 106 bits (264), Expect = 4e-21 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = -1 Query: 514 EDVPIRVMKNLRVCGDCHTAIKLISNITKREIILRDANRFHHFKDGVCSCKDYW 353 E +PIRVMKNLRVCGDCH+AIKLI+ IT REIILRDANRFHHFKDG CSC+DYW Sbjct: 653 EGMPIRVMKNLRVCGDCHSAIKLIAKITSREIILRDANRFHHFKDGFCSCRDYW 706 >ref|NP_001173399.1| Os03g0317100 [Oryza sativa Japonica Group] gi|255674461|dbj|BAH92127.1| Os03g0317100 [Oryza sativa Japonica Group] Length = 706 Score = 106 bits (264), Expect = 4e-21 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = -1 Query: 514 EDVPIRVMKNLRVCGDCHTAIKLISNITKREIILRDANRFHHFKDGVCSCKDYW 353 E +PIRVMKNLRVCGDCH+AIKLI+ IT REIILRDANRFHHFKDG CSC+DYW Sbjct: 653 EGMPIRVMKNLRVCGDCHSAIKLIAKITSREIILRDANRFHHFKDGFCSCRDYW 706 >gb|ABF95626.1| pentatricopeptide, putative [Oryza sativa Japonica Group] gi|125586055|gb|EAZ26719.1| hypothetical protein OsJ_10627 [Oryza sativa Japonica Group] Length = 798 Score = 106 bits (264), Expect = 4e-21 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = -1 Query: 514 EDVPIRVMKNLRVCGDCHTAIKLISNITKREIILRDANRFHHFKDGVCSCKDYW 353 E +PIRVMKNLRVCGDCH+AIKLI+ IT REIILRDANRFHHFKDG CSC+DYW Sbjct: 653 EGMPIRVMKNLRVCGDCHSAIKLIAKITSREIILRDANRFHHFKDGFCSCRDYW 706 >ref|XP_006651327.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Oryza brachyantha] Length = 733 Score = 105 bits (263), Expect = 5e-21 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = -1 Query: 514 EDVPIRVMKNLRVCGDCHTAIKLISNITKREIILRDANRFHHFKDGVCSCKDYW 353 E +PIRVMKNLRVCGDCH+AIKLI+ IT REIILRDANRFHHFKDG CSC+DYW Sbjct: 680 EGMPIRVMKNLRVCGDCHSAIKLIAKITAREIILRDANRFHHFKDGFCSCRDYW 733 >ref|XP_006428236.1| hypothetical protein CICLE_v10011195mg [Citrus clementina] gi|568854166|ref|XP_006480704.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Citrus sinensis] gi|557530293|gb|ESR41476.1| hypothetical protein CICLE_v10011195mg [Citrus clementina] Length = 703 Score = 105 bits (263), Expect = 5e-21 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = -1 Query: 514 EDVPIRVMKNLRVCGDCHTAIKLISNITKREIILRDANRFHHFKDGVCSCKDYW 353 E VPIRVMKNLRVCGDCH+AIKLIS + REIILRDANRFHHFKDG+CSC+DYW Sbjct: 650 EGVPIRVMKNLRVCGDCHSAIKLISKVMGREIILRDANRFHHFKDGLCSCRDYW 703 >gb|EAY89771.1| hypothetical protein OsI_11313 [Oryza sativa Indica Group] Length = 798 Score = 105 bits (263), Expect = 5e-21 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = -1 Query: 514 EDVPIRVMKNLRVCGDCHTAIKLISNITKREIILRDANRFHHFKDGVCSCKDYW 353 E +PIRVMKNLRVCGDCH+AIKLI+ IT REI+LRDANRFHHFKDG CSC+DYW Sbjct: 653 EGMPIRVMKNLRVCGDCHSAIKLIAKITSREIVLRDANRFHHFKDGFCSCRDYW 706 >ref|XP_002277031.2| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Vitis vinifera] Length = 703 Score = 105 bits (262), Expect = 6e-21 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = -1 Query: 514 EDVPIRVMKNLRVCGDCHTAIKLISNITKREIILRDANRFHHFKDGVCSCKDYW 353 E +PIRVMKNLRVCGDCH+AIKLI+ IT REIILRDANRFHHFKDG CSC+DYW Sbjct: 650 EGMPIRVMKNLRVCGDCHSAIKLIAKITGREIILRDANRFHHFKDGFCSCRDYW 703 >ref|XP_003558041.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Brachypodium distachyon] Length = 706 Score = 105 bits (262), Expect = 6e-21 Identities = 45/52 (86%), Positives = 50/52 (96%) Frame = -1 Query: 508 VPIRVMKNLRVCGDCHTAIKLISNITKREIILRDANRFHHFKDGVCSCKDYW 353 +PIRVMKNLRVCGDCH+AIKLI+ IT REIILRDANRFHHFKDG+CSC+DYW Sbjct: 655 MPIRVMKNLRVCGDCHSAIKLITKITSREIILRDANRFHHFKDGLCSCRDYW 706 >ref|XP_003533650.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Glycine max] Length = 711 Score = 105 bits (262), Expect = 6e-21 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = -1 Query: 514 EDVPIRVMKNLRVCGDCHTAIKLISNITKREIILRDANRFHHFKDGVCSCKDYW 353 E +PIRVMKNLRVCGDCH+AIKLI+ +T REIILRDANRFHHFKDG CSCKDYW Sbjct: 658 EGMPIRVMKNLRVCGDCHSAIKLIAKVTGREIILRDANRFHHFKDGHCSCKDYW 711 >emb|CBI39641.3| unnamed protein product [Vitis vinifera] Length = 251 Score = 105 bits (262), Expect = 6e-21 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = -1 Query: 514 EDVPIRVMKNLRVCGDCHTAIKLISNITKREIILRDANRFHHFKDGVCSCKDYW 353 E +PIRVMKNLRVCGDCH+AIKLI+ IT REIILRDANRFHHFKDG CSC+DYW Sbjct: 198 EGMPIRVMKNLRVCGDCHSAIKLIAKITGREIILRDANRFHHFKDGFCSCRDYW 251 >ref|XP_006301656.1| hypothetical protein CARUB_v10022106mg [Capsella rubella] gi|482570366|gb|EOA34554.1| hypothetical protein CARUB_v10022106mg [Capsella rubella] Length = 705 Score = 105 bits (261), Expect = 8e-21 Identities = 46/54 (85%), Positives = 49/54 (90%) Frame = -1 Query: 514 EDVPIRVMKNLRVCGDCHTAIKLISNITKREIILRDANRFHHFKDGVCSCKDYW 353 E VPIRVMKNLRVCGDCH AIKLIS +T+REIILRDANRFHHF +G CSCKDYW Sbjct: 652 EGVPIRVMKNLRVCGDCHAAIKLISKVTEREIILRDANRFHHFNNGECSCKDYW 705 >ref|XP_004242257.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Solanum lycopersicum] Length = 1224 Score = 105 bits (261), Expect = 8e-21 Identities = 44/54 (81%), Positives = 51/54 (94%) Frame = -1 Query: 514 EDVPIRVMKNLRVCGDCHTAIKLISNITKREIILRDANRFHHFKDGVCSCKDYW 353 + +PIR+MKNLRVCGDCH+AIKLI+ +T REIILRDANRFHHFKDGVCSCKD+W Sbjct: 1171 QGMPIRIMKNLRVCGDCHSAIKLIAKVTGREIILRDANRFHHFKDGVCSCKDFW 1224 >ref|XP_004492592.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, mitochondrial-like [Cicer arietinum] Length = 707 Score = 104 bits (260), Expect = 1e-20 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = -1 Query: 514 EDVPIRVMKNLRVCGDCHTAIKLISNITKREIILRDANRFHHFKDGVCSCKDYW 353 E +PIRVMKNLRVCGDCH+AIKLI+ +T REIILRDANRFHHFKDG CSCKD+W Sbjct: 654 EGMPIRVMKNLRVCGDCHSAIKLIAKVTGREIILRDANRFHHFKDGYCSCKDFW 707 >ref|XP_003623648.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355498663|gb|AES79866.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 707 Score = 104 bits (259), Expect = 1e-20 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = -1 Query: 514 EDVPIRVMKNLRVCGDCHTAIKLISNITKREIILRDANRFHHFKDGVCSCKDYW 353 E +PIRVMKNLRVCGDCH+AIKLI+ +T REIILRDANRFHHFKDG CSCKD+W Sbjct: 654 EGMPIRVMKNLRVCGDCHSAIKLIAKVTGREIILRDANRFHHFKDGSCSCKDFW 707 >ref|XP_007140043.1| hypothetical protein PHAVU_008G079600g [Phaseolus vulgaris] gi|561013176|gb|ESW12037.1| hypothetical protein PHAVU_008G079600g [Phaseolus vulgaris] Length = 709 Score = 103 bits (258), Expect = 2e-20 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = -1 Query: 508 VPIRVMKNLRVCGDCHTAIKLISNITKREIILRDANRFHHFKDGVCSCKDYW 353 +PIRVMKNLRVCGDCH+AIKLI+ +T REIILRDANRFHHFKDG CSCKDYW Sbjct: 658 MPIRVMKNLRVCGDCHSAIKLIAKVTGREIILRDANRFHHFKDGHCSCKDYW 709 >ref|NP_176062.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75173061|sp|Q9FXB9.1|PPR84_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g56690, mitochondrial; Flags: Precursor gi|9954744|gb|AAG09095.1|AC009323_6 Hypothetical protein [Arabidopsis thaliana] gi|332195302|gb|AEE33423.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 704 Score = 103 bits (258), Expect = 2e-20 Identities = 45/54 (83%), Positives = 49/54 (90%) Frame = -1 Query: 514 EDVPIRVMKNLRVCGDCHTAIKLISNITKREIILRDANRFHHFKDGVCSCKDYW 353 E VPIRVMKNLRVCGDCH AIKLIS +T+REIILRDANRFHHF +G CSC+DYW Sbjct: 651 EGVPIRVMKNLRVCGDCHAAIKLISKVTEREIILRDANRFHHFNNGECSCRDYW 704