BLASTX nr result
ID: Mentha26_contig00033533
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00033533 (432 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB61345.1| Geranylgeranyl transferase type-2 subunit beta [M... 59 5e-07 ref|XP_006447448.1| hypothetical protein CICLE_v10015999mg [Citr... 59 5e-07 ref|XP_007010502.1| RAB geranylgeranyl transferase beta subunit ... 59 5e-07 ref|XP_004504351.1| PREDICTED: geranylgeranyl transferase type-2... 59 5e-07 gb|EXC04276.1| Geranylgeranyl transferase type-2 subunit beta [M... 58 1e-06 gb|ACJ83453.1| unknown [Medicago truncatula] 58 1e-06 ref|XP_002319501.2| putative Rab geranylgeranyl transferase type... 58 2e-06 ref|NP_001242036.1| uncharacterized protein LOC100793642 [Glycin... 58 2e-06 gb|AAQ62584.1| putative Rab geranylgeranyl transferase type II b... 58 2e-06 ref|XP_006399737.1| hypothetical protein EUTSA_v10014116mg [Eutr... 57 4e-06 gb|EMT05977.1| Geranylgeranyl transferase type-2 subunit beta [A... 57 4e-06 ref|XP_004135836.1| PREDICTED: geranylgeranyl transferase type-2... 57 4e-06 dbj|BAJ97358.1| predicted protein [Hordeum vulgare subsp. vulgare] 57 4e-06 ref|XP_006407374.1| hypothetical protein EUTSA_v10021168mg [Eutr... 56 6e-06 ref|XP_007215711.1| hypothetical protein PRUPE_ppa008926mg [Prun... 56 6e-06 ref|XP_002275861.1| PREDICTED: geranylgeranyl transferase type-2... 56 6e-06 ref|XP_002281543.1| PREDICTED: geranylgeranyl transferase type-2... 56 6e-06 gb|EYU19324.1| hypothetical protein MIMGU_mgv1a010421mg [Mimulus... 55 8e-06 ref|XP_003524939.2| PREDICTED: LOW QUALITY PROTEIN: geranylgeran... 55 8e-06 >gb|EXB61345.1| Geranylgeranyl transferase type-2 subunit beta [Morus notabilis] Length = 372 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 432 AGLSLLEYPQLKAIDPAYALPVDVVNRIFL 343 AGLSLLEYP LKAIDPAYALPVDVVNRIFL Sbjct: 341 AGLSLLEYPGLKAIDPAYALPVDVVNRIFL 370 >ref|XP_006447448.1| hypothetical protein CICLE_v10015999mg [Citrus clementina] gi|568830947|ref|XP_006469743.1| PREDICTED: geranylgeranyl transferase type-2 subunit beta-like [Citrus sinensis] gi|557550059|gb|ESR60688.1| hypothetical protein CICLE_v10015999mg [Citrus clementina] Length = 314 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = -1 Query: 432 AGLSLLEYPQLKAIDPAYALPVDVVNRIFLSK 337 AGLSLLEYP LK IDPAYALPVDVVNRIF SK Sbjct: 282 AGLSLLEYPGLKPIDPAYALPVDVVNRIFFSK 313 >ref|XP_007010502.1| RAB geranylgeranyl transferase beta subunit 1 [Theobroma cacao] gi|508727415|gb|EOY19312.1| RAB geranylgeranyl transferase beta subunit 1 [Theobroma cacao] Length = 315 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -1 Query: 432 AGLSLLEYPQLKAIDPAYALPVDVVNRIFLS 340 AGLSLLEYP LKAIDPAYALPVDVVNRIF S Sbjct: 282 AGLSLLEYPGLKAIDPAYALPVDVVNRIFFS 312 >ref|XP_004504351.1| PREDICTED: geranylgeranyl transferase type-2 subunit beta-like [Cicer arietinum] Length = 313 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = -1 Query: 432 AGLSLLEYPQLKAIDPAYALPVDVVNRIFLSK 337 AGLSLLEYP LK IDPAYALPVDVVNRIF SK Sbjct: 282 AGLSLLEYPGLKPIDPAYALPVDVVNRIFFSK 313 >gb|EXC04276.1| Geranylgeranyl transferase type-2 subunit beta [Morus notabilis] Length = 372 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 432 AGLSLLEYPQLKAIDPAYALPVDVVNRIFL 343 AGLSLLEYP +KAIDPAYALPVDVVNRIFL Sbjct: 341 AGLSLLEYPGVKAIDPAYALPVDVVNRIFL 370 >gb|ACJ83453.1| unknown [Medicago truncatula] Length = 63 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 432 AGLSLLEYPQLKAIDPAYALPVDVVNRIFLSK 337 AGLSLLEYP +K IDPAYALPVDVVNRIF SK Sbjct: 32 AGLSLLEYPGVKPIDPAYALPVDVVNRIFFSK 63 >ref|XP_002319501.2| putative Rab geranylgeranyl transferase type II beta subunit family protein [Populus trichocarpa] gi|550324682|gb|EEE95424.2| putative Rab geranylgeranyl transferase type II beta subunit family protein [Populus trichocarpa] Length = 313 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 432 AGLSLLEYPQLKAIDPAYALPVDVVNRIFLSK 337 AGLSLLEYP LKAIDPA+ALPVDVVNRIF K Sbjct: 282 AGLSLLEYPGLKAIDPAHALPVDVVNRIFFQK 313 >ref|NP_001242036.1| uncharacterized protein LOC100793642 [Glycine max] gi|255635594|gb|ACU18147.1| unknown [Glycine max] Length = 317 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 432 AGLSLLEYPQLKAIDPAYALPVDVVNRIFLSK 337 AGLSLLEYP LK +DPAYALPVDVVNRIF +K Sbjct: 282 AGLSLLEYPGLKPVDPAYALPVDVVNRIFFTK 313 >gb|AAQ62584.1| putative Rab geranylgeranyl transferase type II beta subunit [Glycine max] Length = 317 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 432 AGLSLLEYPQLKAIDPAYALPVDVVNRIFLSK 337 AGLSLLEYP LK +DPAYALPVDVVNRIF +K Sbjct: 282 AGLSLLEYPGLKPVDPAYALPVDVVNRIFFTK 313 >ref|XP_006399737.1| hypothetical protein EUTSA_v10014116mg [Eutrema salsugineum] gi|557100827|gb|ESQ41190.1| hypothetical protein EUTSA_v10014116mg [Eutrema salsugineum] Length = 322 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 432 AGLSLLEYPQLKAIDPAYALPVDVVNRIFLSK 337 AGLSLLEYP +KAIDPAYALPVDV+NRI +K Sbjct: 291 AGLSLLEYPGIKAIDPAYALPVDVINRIIFTK 322 >gb|EMT05977.1| Geranylgeranyl transferase type-2 subunit beta [Aegilops tauschii] Length = 356 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 432 AGLSLLEYPQLKAIDPAYALPVDVVNRIFLSK 337 AGLSL+EYP +K IDPAYALP+DVVNRIFL+K Sbjct: 323 AGLSLMEYPGVKPIDPAYALPLDVVNRIFLTK 354 >ref|XP_004135836.1| PREDICTED: geranylgeranyl transferase type-2 subunit beta-like [Cucumis sativus] gi|449490992|ref|XP_004158768.1| PREDICTED: geranylgeranyl transferase type-2 subunit beta-like [Cucumis sativus] Length = 317 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -1 Query: 432 AGLSLLEYPQLKAIDPAYALPVDVVNRIFLSK 337 AGLSLLEYP LK IDPAYALPVDVVNRI L K Sbjct: 282 AGLSLLEYPSLKPIDPAYALPVDVVNRIRLGK 313 >dbj|BAJ97358.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 319 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 432 AGLSLLEYPQLKAIDPAYALPVDVVNRIFLSK 337 AGLSL+EYP +K IDPAYALP+DVVNRIFL+K Sbjct: 286 AGLSLMEYPGVKPIDPAYALPLDVVNRIFLTK 317 >ref|XP_006407374.1| hypothetical protein EUTSA_v10021168mg [Eutrema salsugineum] gi|567200262|ref|XP_006407375.1| hypothetical protein EUTSA_v10021168mg [Eutrema salsugineum] gi|557108520|gb|ESQ48827.1| hypothetical protein EUTSA_v10021168mg [Eutrema salsugineum] gi|557108521|gb|ESQ48828.1| hypothetical protein EUTSA_v10021168mg [Eutrema salsugineum] Length = 314 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 432 AGLSLLEYPQLKAIDPAYALPVDVVNRIFLSK 337 AGLSLLEYP +K IDPAYALPVDV+NRI L+K Sbjct: 283 AGLSLLEYPGVKPIDPAYALPVDVINRILLTK 314 >ref|XP_007215711.1| hypothetical protein PRUPE_ppa008926mg [Prunus persica] gi|462411861|gb|EMJ16910.1| hypothetical protein PRUPE_ppa008926mg [Prunus persica] Length = 314 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 432 AGLSLLEYPQLKAIDPAYALPVDVVNRIFLSK 337 AGLSLLEYP LKAIDPAYALPVDVV+RI L + Sbjct: 283 AGLSLLEYPGLKAIDPAYALPVDVVDRIILDR 314 >ref|XP_002275861.1| PREDICTED: geranylgeranyl transferase type-2 subunit beta [Vitis vinifera] gi|147860391|emb|CAN82570.1| hypothetical protein VITISV_016117 [Vitis vinifera] gi|296090220|emb|CBI40039.3| unnamed protein product [Vitis vinifera] Length = 317 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 432 AGLSLLEYPQLKAIDPAYALPVDVVNRIFLSK 337 AGL+ LEYP LKA+DPAYALPVDVVNRIF S+ Sbjct: 286 AGLAHLEYPGLKAVDPAYALPVDVVNRIFFSR 317 >ref|XP_002281543.1| PREDICTED: geranylgeranyl transferase type-2 subunit beta [Vitis vinifera] gi|147821440|emb|CAN74579.1| hypothetical protein VITISV_024797 [Vitis vinifera] gi|296081232|emb|CBI17976.3| unnamed protein product [Vitis vinifera] Length = 317 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 432 AGLSLLEYPQLKAIDPAYALPVDVVNRIFLSK 337 AGLSLLEYP +KA+DPAYALPV VVNRIF S+ Sbjct: 286 AGLSLLEYPGVKAVDPAYALPVHVVNRIFFSR 317 >gb|EYU19324.1| hypothetical protein MIMGU_mgv1a010421mg [Mimulus guttatus] Length = 313 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -1 Query: 432 AGLSLLEYPQLKAIDPAYALPVDVVNRIFLSK 337 AGLSLLEY LK IDPAYALPVDVVNRIFL K Sbjct: 282 AGLSLLEYRGLKPIDPAYALPVDVVNRIFLRK 313 >ref|XP_003524939.2| PREDICTED: LOW QUALITY PROTEIN: geranylgeranyl transferase type-2 subunit beta-like [Glycine max] Length = 323 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 432 AGLSLLEYPQLKAIDPAYALPVDVVNRIFLSK 337 AGLSLLEYP LK +DPAYALPVDVVNRI +K Sbjct: 289 AGLSLLEYPGLKPVDPAYALPVDVVNRIIFTK 320