BLASTX nr result
ID: Mentha26_contig00033385
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00033385 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32703.1| hypothetical protein MIMGU_mgv1a001659mg [Mimulus... 55 8e-06 >gb|EYU32703.1| hypothetical protein MIMGU_mgv1a001659mg [Mimulus guttatus] Length = 777 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/64 (40%), Positives = 41/64 (64%) Frame = -3 Query: 308 IFSNIFRLNIEEDVNEVLFALKTDSPINEEQFRKASDIVAEFPEETQKLWSTKAQDLAKS 129 +F N+ L +E+DVNEV+FALK DSPI +++ +A D + + E + WS + D +K Sbjct: 713 VFGNLLSLKLEKDVNEVIFALKKDSPITDDELSRACDELVKSLELEKHEWSQRVVDASKL 772 Query: 128 IERL 117 I+ L Sbjct: 773 IKPL 776