BLASTX nr result
ID: Mentha26_contig00033149
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00033149 (399 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABX75383.1| 60S ribosomal protein L6 [Lycosa singoriensis] 93 3e-17 gb|AFX63977.1| 60S ribosomal protein L6, partial [Botryllus schl... 90 3e-16 gb|AFX63863.1| 60S ribosomal protein L6, partial [Botryllus schl... 90 3e-16 gb|AFX63861.1| 60S ribosomal protein L6, partial [Botryllus schl... 90 3e-16 gb|AFX63870.1| 60S ribosomal protein L6, partial [Botryllus schl... 89 5e-16 gb|ACD65157.1| putative 60S ribosomal protein RPL6 [Phoronis mue... 89 5e-16 gb|AFX63987.1| 60S ribosomal protein L6, partial [Botryllus schl... 89 6e-16 gb|ABW23213.1| ribosomal protein rpl6 [Eurythoe complanata] 89 6e-16 gb|ETE71629.1| 60S ribosomal protein L6, partial [Ophiophagus ha... 88 1e-15 gb|AFX63866.1| 60S ribosomal protein L6, partial [Botryllus schl... 86 5e-15 gb|AHH81773.1| 60S ribosomal protein L6-like protein, partial [B... 85 9e-15 ref|NP_989483.1| 60S ribosomal protein L6 [Gallus gallus] gi|170... 85 9e-15 ref|XP_002611830.1| hypothetical protein BRAFLDRAFT_114734 [Bran... 85 9e-15 ref|XP_003211012.1| PREDICTED: 60S ribosomal protein L6-like [Me... 85 1e-14 ref|XP_007433584.1| PREDICTED: 60S ribosomal protein L6 [Python ... 84 2e-14 ref|XP_005097810.1| PREDICTED: 60S ribosomal protein L6-like [Ap... 84 2e-14 gb|ADY18390.1| ribosomal protein rpl6 [Glycera tridactyla] 84 2e-14 gb|ACD65112.1| putative 60S ribosomal protein RPL6 [Novocrania a... 84 2e-14 gb|ADF47162.1| ribosomal protein L6 [Hemiscyllium ocellatum] 84 2e-14 gb|ABZ04219.1| ribosomal protein rpl6 [Lineus viridis] 84 2e-14 >gb|ABX75383.1| 60S ribosomal protein L6 [Lycosa singoriensis] Length = 238 Score = 93.2 bits (230), Expect = 3e-17 Identities = 45/94 (47%), Positives = 66/94 (70%), Gaps = 1/94 (1%) Frame = +3 Query: 120 LWAKIRRMAKKKGVKPDTLVKRRAKFIVKPISGEKNGGKRLVRVNKGPRFYPTEPRPKKR 299 ++++ R M KK P +R+ K +VKPI GEKNGG R+VR+ K +FYPTE +P+ + Sbjct: 38 MYSRRRLMKVKKTTTPKEKPERKPKTVVKPIGGEKNGGTRVVRLKKPKKFYPTEDKPRLK 97 Query: 300 RTGK-ITFKMHKRHYKKGISPGRIVIILAGRHKG 398 RT K + FK KR+ +K I+PG ++I+LAGRH+G Sbjct: 98 RTRKMVAFKNCKRNLRKRITPGTVLILLAGRHRG 131 >gb|AFX63977.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210680|gb|AFX63978.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] Length = 169 Score = 90.1 bits (222), Expect = 3e-16 Identities = 46/89 (51%), Positives = 59/89 (66%), Gaps = 1/89 (1%) Frame = +3 Query: 135 RRMAKKKGVKPDTLVKRRAKFIVKPISGEKNGGKRLVRVNKGPRFYPTEPRPKKRRT-GK 311 + + KKK V KR +KPI GEKNGG R VR+ K PR+YPTE RP+K ++ GK Sbjct: 19 KALYKKKRVVTKVEKKRDFMTKIKPIGGEKNGGTRKVRIKKLPRYYPTEDRPRKLKSHGK 78 Query: 312 ITFKMHKRHYKKGISPGRIVIILAGRHKG 398 F HKR+ + I+PG ++IILAGRHKG Sbjct: 79 KPFSQHKRNLRDSITPGTVLIILAGRHKG 107 >gb|AFX63863.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210452|gb|AFX63864.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210460|gb|AFX63868.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210466|gb|AFX63871.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210468|gb|AFX63872.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210470|gb|AFX63873.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210472|gb|AFX63874.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210476|gb|AFX63876.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210480|gb|AFX63878.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210482|gb|AFX63879.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210484|gb|AFX63880.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210486|gb|AFX63881.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210488|gb|AFX63882.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210490|gb|AFX63883.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210492|gb|AFX63884.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210494|gb|AFX63885.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210496|gb|AFX63886.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210498|gb|AFX63887.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210500|gb|AFX63888.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210502|gb|AFX63889.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210504|gb|AFX63890.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210506|gb|AFX63891.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210508|gb|AFX63892.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210510|gb|AFX63893.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210512|gb|AFX63894.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210514|gb|AFX63895.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210516|gb|AFX63896.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210518|gb|AFX63897.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210520|gb|AFX63898.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210522|gb|AFX63899.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210524|gb|AFX63900.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210526|gb|AFX63901.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210528|gb|AFX63902.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210530|gb|AFX63903.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210532|gb|AFX63904.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210534|gb|AFX63905.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210536|gb|AFX63906.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210538|gb|AFX63907.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210540|gb|AFX63908.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210542|gb|AFX63909.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210544|gb|AFX63910.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210546|gb|AFX63911.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210548|gb|AFX63912.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210550|gb|AFX63913.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210552|gb|AFX63914.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210554|gb|AFX63915.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210556|gb|AFX63916.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210558|gb|AFX63917.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210560|gb|AFX63918.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210562|gb|AFX63919.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210564|gb|AFX63920.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210566|gb|AFX63921.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210568|gb|AFX63922.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210570|gb|AFX63923.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210572|gb|AFX63924.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210574|gb|AFX63925.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210576|gb|AFX63926.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210578|gb|AFX63927.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210580|gb|AFX63928.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210582|gb|AFX63929.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210584|gb|AFX63930.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210586|gb|AFX63931.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210588|gb|AFX63932.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210594|gb|AFX63935.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210596|gb|AFX63936.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210598|gb|AFX63937.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210600|gb|AFX63938.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210602|gb|AFX63939.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210604|gb|AFX63940.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210606|gb|AFX63941.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210608|gb|AFX63942.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210610|gb|AFX63943.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210612|gb|AFX63944.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210614|gb|AFX63945.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210616|gb|AFX63946.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210618|gb|AFX63947.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210620|gb|AFX63948.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210622|gb|AFX63949.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210624|gb|AFX63950.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210626|gb|AFX63951.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210628|gb|AFX63952.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210630|gb|AFX63953.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210632|gb|AFX63954.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210634|gb|AFX63955.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210636|gb|AFX63956.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210638|gb|AFX63957.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210640|gb|AFX63958.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210642|gb|AFX63959.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210644|gb|AFX63960.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210646|gb|AFX63961.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210648|gb|AFX63962.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210650|gb|AFX63963.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210652|gb|AFX63964.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210654|gb|AFX63965.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210656|gb|AFX63966.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210688|gb|AFX63982.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210692|gb|AFX63984.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210696|gb|AFX63986.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210700|gb|AFX63988.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210704|gb|AFX63990.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210706|gb|AFX63991.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210708|gb|AFX63992.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210710|gb|AFX63993.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210712|gb|AFX63994.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210722|gb|AFX63999.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210724|gb|AFX64000.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210726|gb|AFX64001.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210730|gb|AFX64003.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210734|gb|AFX64005.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210738|gb|AFX64007.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] Length = 170 Score = 90.1 bits (222), Expect = 3e-16 Identities = 46/89 (51%), Positives = 59/89 (66%), Gaps = 1/89 (1%) Frame = +3 Query: 135 RRMAKKKGVKPDTLVKRRAKFIVKPISGEKNGGKRLVRVNKGPRFYPTEPRPKKRRT-GK 311 + + KKK V KR +KPI GEKNGG R VR+ K PR+YPTE RP+K ++ GK Sbjct: 20 KALYKKKRVVSKVEKKRDFMTKIKPIGGEKNGGTRKVRIKKLPRYYPTEDRPRKLKSHGK 79 Query: 312 ITFKMHKRHYKKGISPGRIVIILAGRHKG 398 F HKR+ + I+PG ++IILAGRHKG Sbjct: 80 KPFSQHKRNLRDSITPGTVLIILAGRHKG 108 >gb|AFX63861.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210448|gb|AFX63862.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210454|gb|AFX63865.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210458|gb|AFX63867.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210462|gb|AFX63869.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210474|gb|AFX63875.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210478|gb|AFX63877.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210590|gb|AFX63933.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210592|gb|AFX63934.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210658|gb|AFX63967.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210660|gb|AFX63968.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210662|gb|AFX63969.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210664|gb|AFX63970.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210666|gb|AFX63971.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210668|gb|AFX63972.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210670|gb|AFX63973.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210672|gb|AFX63974.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210674|gb|AFX63975.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210676|gb|AFX63976.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210682|gb|AFX63979.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210684|gb|AFX63980.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210686|gb|AFX63981.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210690|gb|AFX63983.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210694|gb|AFX63985.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210702|gb|AFX63989.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210714|gb|AFX63995.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210716|gb|AFX63996.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210718|gb|AFX63997.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210720|gb|AFX63998.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] Length = 170 Score = 90.1 bits (222), Expect = 3e-16 Identities = 46/89 (51%), Positives = 59/89 (66%), Gaps = 1/89 (1%) Frame = +3 Query: 135 RRMAKKKGVKPDTLVKRRAKFIVKPISGEKNGGKRLVRVNKGPRFYPTEPRPKKRRT-GK 311 + + KKK V KR +KPI GEKNGG R VR+ K PR+YPTE RP+K ++ GK Sbjct: 20 KALYKKKRVVTKVEKKRDFMTKIKPIGGEKNGGTRKVRIKKLPRYYPTEDRPRKLKSHGK 79 Query: 312 ITFKMHKRHYKKGISPGRIVIILAGRHKG 398 F HKR+ + I+PG ++IILAGRHKG Sbjct: 80 KPFSQHKRNLRDSITPGTVLIILAGRHKG 108 >gb|AFX63870.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210728|gb|AFX64002.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210732|gb|AFX64004.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210736|gb|AFX64006.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] gi|418210740|gb|AFX64008.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] Length = 170 Score = 89.4 bits (220), Expect = 5e-16 Identities = 46/89 (51%), Positives = 59/89 (66%), Gaps = 1/89 (1%) Frame = +3 Query: 135 RRMAKKKGVKPDTLVKRRAKFIVKPISGEKNGGKRLVRVNKGPRFYPTEPRPKKRRT-GK 311 + + KKK V KR +KPI GEKNGG R VR+ K PR+YPTE RP+K ++ GK Sbjct: 20 KALYKKKRVVSKVEKKRDFMTKIKPIGGEKNGGTRKVRIKKLPRYYPTEDRPRKLKSHGK 79 Query: 312 ITFKMHKRHYKKGISPGRIVIILAGRHKG 398 F HKR+ + I+PG ++IILAGRHKG Sbjct: 80 KPFSHHKRNLRDSITPGTVLIILAGRHKG 108 >gb|ACD65157.1| putative 60S ribosomal protein RPL6 [Phoronis muelleri] Length = 237 Score = 89.4 bits (220), Expect = 5e-16 Identities = 45/100 (45%), Positives = 62/100 (62%), Gaps = 2/100 (2%) Frame = +3 Query: 105 KRTRPLWAKIRRMAKKKGVKPDTLVKRRAKFIVKPISGEKNGGKRLVRVNKGPRFYPTEP 284 K+ R WAK KG K + A+ + K I GEKNGGKR V VN+ PRFYPTE Sbjct: 24 KKNRSRWAK-------KGQKSTDKTQTAARVVTKDIGGEKNGGKRTVPVNRMPRFYPTED 76 Query: 285 RPKKRRTGK--ITFKMHKRHYKKGISPGRIVIILAGRHKG 398 + ++ +T K ++F HKR + ++PG ++I+LAGRHKG Sbjct: 77 KQRRLKTYKQRVSFSQHKRRLRPSLTPGTVLILLAGRHKG 116 >gb|AFX63987.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] Length = 170 Score = 89.0 bits (219), Expect = 6e-16 Identities = 46/89 (51%), Positives = 59/89 (66%), Gaps = 1/89 (1%) Frame = +3 Query: 135 RRMAKKKGVKPDTLVKRRAKFIVKPISGEKNGGKRLVRVNKGPRFYPTEPRPKKRRT-GK 311 + + KKK V KR +KPI GEKNGG R VR+ K PR+YPTE RP+K ++ GK Sbjct: 20 KALYKKKRVVTKVEKKRDFMTKIKPIGGEKNGGTRNVRIKKLPRYYPTEDRPRKLKSHGK 79 Query: 312 ITFKMHKRHYKKGISPGRIVIILAGRHKG 398 F HKR+ + I+PG ++IILAGRHKG Sbjct: 80 KPFSHHKRNLRDSITPGTVLIILAGRHKG 108 >gb|ABW23213.1| ribosomal protein rpl6 [Eurythoe complanata] Length = 225 Score = 89.0 bits (219), Expect = 6e-16 Identities = 39/84 (46%), Positives = 58/84 (69%) Frame = +3 Query: 147 KKKGVKPDTLVKRRAKFIVKPISGEKNGGKRLVRVNKGPRFYPTEPRPKKRRTGKITFKM 326 KK G K + + + + + KPI G+KNGG R+VR+++ PR+YPTE RP+K + K F Sbjct: 38 KKAGQKKEEKKQGQPRLVTKPIGGDKNGGSRVVRLSRMPRYYPTEDRPRKLPSRKNAFSQ 97 Query: 327 HKRHYKKGISPGRIVIILAGRHKG 398 HKR + I+PG ++I++AGRHKG Sbjct: 98 HKRKLRSTITPGTVLILVAGRHKG 121 >gb|ETE71629.1| 60S ribosomal protein L6, partial [Ophiophagus hannah] Length = 287 Score = 87.8 bits (216), Expect = 1e-15 Identities = 41/89 (46%), Positives = 60/89 (67%), Gaps = 1/89 (1%) Frame = +3 Query: 135 RRMAKKKGVKPDTLVKRRAKFIVKPISGEKNGGKRLVRVNKGPRFYPTEPRPKKRRT-GK 311 + M K+K P+T ++ A + KP+ G+KNGG R+V++ K PR+YPTE P+K + GK Sbjct: 37 KAMYKRKYNAPETKKEKEAATVTKPVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLLSHGK 96 Query: 312 ITFKMHKRHYKKGISPGRIVIILAGRHKG 398 F +HKR + ISPG +VI+L GRH+G Sbjct: 97 KNFALHKRRLRGSISPGTVVILLTGRHRG 125 >gb|AFX63866.1| 60S ribosomal protein L6, partial [Botryllus schlosseri] Length = 170 Score = 85.9 bits (211), Expect = 5e-15 Identities = 45/89 (50%), Positives = 58/89 (65%), Gaps = 1/89 (1%) Frame = +3 Query: 135 RRMAKKKGVKPDTLVKRRAKFIVKPISGEKNGGKRLVRVNKGPRFYPTEPRPKKRRT-GK 311 + + KKK V KR +KPI GEKNGG R V + K PR+YPTE RP+K ++ GK Sbjct: 20 KALYKKKRVVTKVEKKRDFMTKIKPIGGEKNGGTRNVWIKKLPRYYPTEDRPRKLKSHGK 79 Query: 312 ITFKMHKRHYKKGISPGRIVIILAGRHKG 398 F HKR+ + I+PG ++IILAGRHKG Sbjct: 80 KPFSHHKRNLRDSITPGTVLIILAGRHKG 108 >gb|AHH81773.1| 60S ribosomal protein L6-like protein, partial [Biomphalaria glabrata] Length = 198 Score = 85.1 bits (209), Expect = 9e-15 Identities = 38/75 (50%), Positives = 54/75 (72%) Frame = +3 Query: 174 LVKRRAKFIVKPISGEKNGGKRLVRVNKGPRFYPTEPRPKKRRTGKITFKMHKRHYKKGI 353 +VK+ KF+ K I G+KNGG+R VRV + RFYPTE + +K ++ K F HKR+ + I Sbjct: 3 VVKKGEKFVTKKIGGDKNGGERKVRVKRLSRFYPTEDKARKLKSHKKAFSQHKRNLRASI 62 Query: 354 SPGRIVIILAGRHKG 398 +PG ++I+LAGRHKG Sbjct: 63 TPGTVLILLAGRHKG 77 >ref|NP_989483.1| 60S ribosomal protein L6 [Gallus gallus] gi|17025728|gb|AAK52090.1| tax-responsive element binding protein 107 [Gallus gallus] Length = 298 Score = 85.1 bits (209), Expect = 9e-15 Identities = 40/94 (42%), Positives = 62/94 (65%), Gaps = 6/94 (6%) Frame = +3 Query: 135 RRMAKKKGVKPDTLVKRRAK-----FIVKPISGEKNGGKRLVRVNKGPRFYPTEPRPKKR 299 + + K+K P+T ++++ K I+KP+ G+KNGG R+V+V K PR+YPTE P+K Sbjct: 76 KALYKRKYTAPETKIEKKKKEKPRATIIKPVGGDKNGGSRVVKVRKMPRYYPTEDVPRKL 135 Query: 300 RT-GKITFKMHKRHYKKGISPGRIVIILAGRHKG 398 + GK F HKR + I+PG ++I+L GRH+G Sbjct: 136 LSHGKKPFSQHKRRLRASITPGTVLILLTGRHRG 169 >ref|XP_002611830.1| hypothetical protein BRAFLDRAFT_114734 [Branchiostoma floridae] gi|229297202|gb|EEN67839.1| hypothetical protein BRAFLDRAFT_114734 [Branchiostoma floridae] Length = 256 Score = 85.1 bits (209), Expect = 9e-15 Identities = 38/93 (40%), Positives = 62/93 (66%) Frame = +3 Query: 120 LWAKIRRMAKKKGVKPDTLVKRRAKFIVKPISGEKNGGKRLVRVNKGPRFYPTEPRPKKR 299 ++ +I++ KK K +T K+ +F+ K I G+KNGG R V V++ P++YPTE P+K Sbjct: 36 MYERIKKALKKPRAKTET--KKNTRFVNKDIGGDKNGGTRKVPVSRTPKYYPTEDVPRKL 93 Query: 300 RTGKITFKMHKRHYKKGISPGRIVIILAGRHKG 398 R+ K F HK+ + I+PG ++I+++GRHKG Sbjct: 94 RSNKKPFSQHKKKLRPSITPGTVLILVSGRHKG 126 >ref|XP_003211012.1| PREDICTED: 60S ribosomal protein L6-like [Meleagris gallopavo] Length = 308 Score = 84.7 bits (208), Expect = 1e-14 Identities = 39/94 (41%), Positives = 62/94 (65%), Gaps = 6/94 (6%) Frame = +3 Query: 135 RRMAKKKGVKPDTLVKRRAK-----FIVKPISGEKNGGKRLVRVNKGPRFYPTEPRPKKR 299 + + K+K P+T ++++ K ++KP+ G+KNGG R+V+V K PR+YPTE P+K Sbjct: 86 KALYKRKYTAPETKIEKKKKEKPRATVIKPVGGDKNGGSRVVKVRKMPRYYPTEDVPRKL 145 Query: 300 RT-GKITFKMHKRHYKKGISPGRIVIILAGRHKG 398 + GK F HKR + I+PG ++I+L GRH+G Sbjct: 146 LSHGKKPFSQHKRRLRASITPGTVLILLTGRHRG 179 >ref|XP_007433584.1| PREDICTED: 60S ribosomal protein L6 [Python bivittatus] Length = 259 Score = 84.3 bits (207), Expect = 2e-14 Identities = 40/94 (42%), Positives = 62/94 (65%), Gaps = 6/94 (6%) Frame = +3 Query: 135 RRMAKKKGVKPDTLVKRRAK-----FIVKPISGEKNGGKRLVRVNKGPRFYPTEPRPKKR 299 + M K+K P+T ++++ K + KP+ G+KNGG R+V++ K PR+YPTE P+K Sbjct: 37 KAMYKRKYNAPETKIEKKKKEKEAATVTKPVGGDKNGGNRVVKLRKMPRYYPTEDVPRKL 96 Query: 300 RT-GKITFKMHKRHYKKGISPGRIVIILAGRHKG 398 + GK F +HKR + I+PG +VI+L GRH+G Sbjct: 97 LSHGKKNFALHKRRLRASITPGTVVILLTGRHRG 130 >ref|XP_005097810.1| PREDICTED: 60S ribosomal protein L6-like [Aplysia californica] Length = 209 Score = 84.3 bits (207), Expect = 2e-14 Identities = 37/73 (50%), Positives = 52/73 (71%) Frame = +3 Query: 180 KRRAKFIVKPISGEKNGGKRLVRVNKGPRFYPTEPRPKKRRTGKITFKMHKRHYKKGISP 359 K +F+ K I G+KNGG+R VRV + PRFYPTE +P+K + + +F HKR + I+P Sbjct: 5 KPAQEFVTKKIGGDKNGGERKVRVKRLPRFYPTEDKPRKLKNYQKSFSQHKRRLRASITP 64 Query: 360 GRIVIILAGRHKG 398 G ++I+LAGRHKG Sbjct: 65 GTVLILLAGRHKG 77 >gb|ADY18390.1| ribosomal protein rpl6 [Glycera tridactyla] Length = 202 Score = 84.3 bits (207), Expect = 2e-14 Identities = 37/70 (52%), Positives = 50/70 (71%) Frame = +3 Query: 189 AKFIVKPISGEKNGGKRLVRVNKGPRFYPTEPRPKKRRTGKITFKMHKRHYKKGISPGRI 368 A+ + K I G+KNGG R VR+N+ PR+YPTE P K + K FK HKR+ + I+PG + Sbjct: 1 ARVVTKEIKGDKNGGSRKVRINRMPRYYPTEEYPHKLASRKAPFKAHKRNLRPSITPGTV 60 Query: 369 VIILAGRHKG 398 +I+LAGRHKG Sbjct: 61 LILLAGRHKG 70 >gb|ACD65112.1| putative 60S ribosomal protein RPL6 [Novocrania anomala] Length = 145 Score = 84.3 bits (207), Expect = 2e-14 Identities = 40/83 (48%), Positives = 52/83 (62%) Frame = +3 Query: 150 KKGVKPDTLVKRRAKFIVKPISGEKNGGKRLVRVNKGPRFYPTEPRPKKRRTGKITFKMH 329 K G K K + + K I GEKNGG R +RV + PRFYPTE RP+K T K F H Sbjct: 34 KAGQKKADKSKTTPRMVKKDIGGEKNGGSRTIRVTRMPRFYPTEDRPRKLHTRKKPFSEH 93 Query: 330 KRHYKKGISPGRIVIILAGRHKG 398 +R + I+PG I+I++AG+HKG Sbjct: 94 RRKLRPSITPGTILILVAGKHKG 116 >gb|ADF47162.1| ribosomal protein L6 [Hemiscyllium ocellatum] Length = 212 Score = 84.0 bits (206), Expect = 2e-14 Identities = 40/89 (44%), Positives = 59/89 (66%), Gaps = 6/89 (6%) Frame = +3 Query: 147 KKKGVKPDTLVKRRAK-----FIVKPISGEKNGGKRLVRVNKGPRFYPTEPRPKKRRT-G 308 K+K P+T ++++ K I KP+ G+KNGG R+V++ K PR+YPTE P+KR + G Sbjct: 1 KRKYKAPETKIEKKLKEKTPFSITKPVGGDKNGGTRVVKIRKMPRYYPTEDVPRKRISHG 60 Query: 309 KITFKMHKRHYKKGISPGRIVIILAGRHK 395 F HKRH + I+PG ++IIL GRH+ Sbjct: 61 NKPFSQHKRHLRASITPGTVLIILTGRHR 89 >gb|ABZ04219.1| ribosomal protein rpl6 [Lineus viridis] Length = 201 Score = 84.0 bits (206), Expect = 2e-14 Identities = 40/73 (54%), Positives = 49/73 (67%) Frame = +3 Query: 180 KRRAKFIVKPISGEKNGGKRLVRVNKGPRFYPTEPRPKKRRTGKITFKMHKRHYKKGISP 359 K A+ + K I GEKNGG R VRVN+ PR YPTE R K +T K F HKR + I+P Sbjct: 8 KAPARMVTKTIGGEKNGGTRTVRVNRLPRHYPTEDRRLKLKTRKNAFSQHKRKLRASITP 67 Query: 360 GRIVIILAGRHKG 398 G ++I+LAGRHKG Sbjct: 68 GTVLILLAGRHKG 80