BLASTX nr result
ID: Mentha26_contig00033054
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00033054 (320 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17674.1| hypothetical protein MIMGU_mgv1a011723mg [Mimulus... 60 4e-07 >gb|EYU17674.1| hypothetical protein MIMGU_mgv1a011723mg [Mimulus guttatus] Length = 272 Score = 59.7 bits (143), Expect = 4e-07 Identities = 34/58 (58%), Positives = 39/58 (67%) Frame = +2 Query: 146 MAVPYANYFQLPKVNPKCHLFSSSSGPSTRVAPAYSCLKSSGPDLHLEAKVDPLLGSV 319 MAVPY+N FQ+PK+N K LFSSS+G TR SS LHL+AKVDPLL SV Sbjct: 1 MAVPYSNCFQIPKINSKSLLFSSSNGICTRA--------SSVKALHLDAKVDPLLDSV 50