BLASTX nr result
ID: Mentha26_contig00033033
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00033033 (320 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43698.1| hypothetical protein MIMGU_mgv1a000899mg [Mimulus... 60 2e-07 >gb|EYU43698.1| hypothetical protein MIMGU_mgv1a000899mg [Mimulus guttatus] Length = 947 Score = 60.5 bits (145), Expect = 2e-07 Identities = 33/51 (64%), Positives = 38/51 (74%), Gaps = 1/51 (1%) Frame = -1 Query: 320 ILASFSLHNLLTNSTDYFSQQPRIENDVL-GCLQKLSRATWTAKELISLIT 171 ILASFSLHNL T TDY +Q +E +VL C+ KL R TWTAKELIS+IT Sbjct: 895 ILASFSLHNL-TKGTDYIIRQSELEKEVLLSCIGKLVRVTWTAKELISVIT 944