BLASTX nr result
ID: Mentha26_contig00033032
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00033032 (309 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43698.1| hypothetical protein MIMGU_mgv1a000899mg [Mimulus... 57 3e-06 >gb|EYU43698.1| hypothetical protein MIMGU_mgv1a000899mg [Mimulus guttatus] Length = 947 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = +1 Query: 1 LASFSLYNLLTNSTDYFLQQPRIENDVL-GCLQRLSRATWTAKELISLIT 147 LASFSL+NL T TDY ++Q +E +VL C+ +L R TWTAKELIS+IT Sbjct: 896 LASFSLHNL-TKGTDYIIRQSELEKEVLLSCIGKLVRVTWTAKELISVIT 944